Overview

  • Product name
  • Description
    Rabbit polyclonal to SIRT4
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Rat SIRT4 aa 60-255. (Expressed in E.coli).
    Sequence:

    AGISTESGIPDYRSEKVGLYARTDRRPIQHIDFIRSAPVRQRYWARNFVG WPQFSSHQPNPAHWALSNWEKLGKLHWLVTQNVDALHSKAGNQRLTELHG CMHRVLCLSCGEQTARRVLQDRFQALNPSWSAEAQGVAPDGDVFLTEEQV RSFRVPCCDRCGGPLKPDVVFFGDTVNPDKVDFVHQRVKEADSLLV


    Database link: G3V641

  • Positive control
    • WB: Recombinant rat SIRT4 protein; HepG2 and HeLa cell lysates; Rat liver lysate. IHC-P: Rat liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231137 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 35 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function
    Acts as NAD-dependent protein lipoamidase, ADP-ribosyl transferase and deacetylase. Catalyzes more efficiently removal of lipoyl- and biotinyl- than acetyl-lysine modifications. Inhibits the pyruvate dehydrogenase complex (PDH) activity via the enzymatic hydrolysis of the lipoamide cofactor from the E2 component, DLAT, in a phosphorylation-independent manner (PubMed:25525879). Catalyzes the transfer of ADP-ribosyl groups onto target proteins, including mitochondrial GLUD1, inhibiting GLUD1 enzyme activity. Acts as a negative regulator of mitochondrial glutamine metabolism by mediating mono ADP-ribosylation of GLUD1: expressed in response to DNA damage and negatively regulates anaplerosis by inhibiting GLUD1, leading to block metabolism of glutamine into tricarboxylic acid cycle and promoting cell cycle arrest (PubMed:16959573, PubMed:17715127). In response to mTORC1 signal, SIRT4 expression is repressed, promoting anaplerosis and cell proliferation. Acts as a tumor suppressor (PubMed:23562301, PubMed:23663782). Also acts as a NAD-dependent protein deacetylase: mediates deacetylation of 'Lys-471' of MLYCD, inhibiting its activity, thereby acting as a regulator of lipid homeostasis (By similarity). Controls fatty acid oxidation by inhibiting PPARA transcriptional activation. Impairs SIRT1:PPARA interaction probably through the regulation of NAD(+) levels (PubMed:24043310). Down-regulates insulin secretion.
  • Tissue specificity
    Detected in vascular smooth muscle and striated muscle. Detected in insulin-producing beta-cells in pancreas islets of Langerhans (at protein level). Widely expressed. Weakly expressed in leukocytes and fetal thymus.
  • Sequence similarities
    Belongs to the sirtuin family. Class II subfamily.
    Contains 1 deacetylase sirtuin-type domain.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt
  • Database links
  • Alternative names
    • MGC130046 antibody
    • MGC130047 antibody
    • MGC57437 antibody
    • NAD dependent deacetylase sirtuin 4 antibody
    • NAD dependent protein deacetylase sirtuin 4 antibody
    • NAD-dependent ADP-ribosyltransferase sirtuin-4 antibody
    • NAD-dependent protein deacetylase sirtuin-4 antibody
    • NAD-dependent protein lipoamidase sirtuin-4, mitochondrial antibody
    • Regulatory protein SIR2 homolog 4 antibody
    • Silent mating type information regulation 2 homolog antibody
    • Sir 2 like 4 antibody
    • SIR 2 like protein 4 antibody
    • Sir2 like 4 antibody
    • SIR2 like protein 4 antibody
    • SIR2-like protein 4 antibody
    • SIR2L 4 antibody
    • SIR2L4 antibody
    • SIR4_HUMAN antibody
    • SIRT 4 antibody
    • Sirt4 antibody
    • Sirtuin (silent mating type information regulation 2 homolog) 4 antibody
    • Sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae) antibody
    • Sirtuin 4 antibody
    • Sirtuin type 4 antibody
    • Sirtuin-4 antibody
    • Sirtuin4 antibody
    see all

Images

  • Anti-SIRT4 antibody (ab231137) at 2 µg/ml + Recombinant rat SIRT4 protein

    Predicted band size: 35 kDa

  • Anti-SIRT4 antibody (ab231137) at 2 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Predicted band size: 35 kDa

  • Anti-SIRT4 antibody (ab231137) at 2 µg/ml + Rat liver lysate

    Predicted band size: 35 kDa

  • Anti-SIRT4 antibody (ab231137) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 35 kDa

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for SIRT4 with ab231137 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231137 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231137.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up