Anti-SIX4 antibody (ab176713)
Key features and details
- Rabbit polyclonal to SIX4
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SIX4 antibody -
Description
Rabbit polyclonal to SIX4 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Human -
Immunogen
Synthetic peptide within Human SIX4 aa 731-781 (C terminal). The exact sequence is proprietary.
Sequence:SKATSSLMMLDSKSKYVLDGMVDTVCEDLETDKKELAKLQTVQLDEDMQD L
Database link: Q9UIU6 -
Positive control
- WB: HeLa and 293T whole cell lysates. IP HeLa whole cell lysate (ab150035).
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 99% Tris buffered saline, 0.2% BSA
pH 7 to 8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab176713 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/2000 - 1/10000. Predicted molecular weight: 83 kDa.
|
|
IP |
Use at 2-10 µg/mg of lysate.
|
Notes |
---|
WB
1/2000 - 1/10000. Predicted molecular weight: 83 kDa. |
IP
Use at 2-10 µg/mg of lysate. |
Target
-
Sequence similarities
Belongs to the SIX/Sine oculis homeobox family.
Contains 1 homeobox DNA-binding domain. -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 51804 Human
- Omim: 606342 Human
- SwissProt: Q9UIU6 Human
- Unigene: 690393 Human
- Unigene: 97849 Human
-
Alternative names
- AREC 3 antibody
- AREC3 antibody
- Homeobox protein SIX4 antibody
see all
Images
-
All lanes : Anti-SIX4 antibody (ab176713) at 0.04 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : 293T whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 83 kDa
Exposure time: 30 seconds -
SIX4 was immunoprecipitated from 1mg HeLa whole cell lysate using ab176713 at 6 μg/mg lysate (Lane 2), a rabbit anti-SIX4 antibody recognizing an upstream epitope (Lane 1) or control IgG (Lane 3). 20% of the Immunoprecipitate was loaded per lane and then immunobotted using ab176713 at 0.4 μg/ml.
Detection: Chemiluminescence with exposure time of 3 seconds.
Protocols
Datasheets and documents
-
Datasheet download
References (1)
ab176713 has been referenced in 1 publication.
- Li Y et al. Upregulation of SIX4 indicates poor clinical outcome and promotes tumor growth and cell metastasis in esophageal squamous cell carcinoma. Thorac Cancer 12:752-759 (2021). PubMed: 33481352