Overview

  • Product name
  • Description
    Mouse polyclonal to Six3
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Full length protein corresponding to Human Six3 aa 1-332.
    Sequence:

    MVFRSPLDLYSSHFLLPNFADSHHRSILLASSGGGNGAGGGGGAGGGSGG GNGAGGGGAGGAGGGGGGGSRAPPEELSMFQLPTLNFSPEQVASVCETLE ETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYH ILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLP RTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQV GNWFKNRRQRDRAAAAKNRLQHQAIGPSGMRSLAEPGCPTHGSAESPSTA ASPTTSVSSLTERADTGTSILSVTSSDSECDV


    Database link: AAI53027.1

  • Positive control
    • Six3 transfected 293T cell line lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172131 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa.

Target

  • Function
    May be involved in visual system development.
  • Involvement in disease
    Defects in SIX3 are the cause of holoprosencephaly type 2 (HPE2) [MIM:157170]. Holoprosencephaly (HPE) [MIM:236100] is the most common structural anomaly of the brain, in which the developing forebrain fails to correctly separate into right and left hemispheres. Holoprosencephaly is genetically heterogeneous and associated with several distinct facies and phenotypic variability.
  • Sequence similarities
    Belongs to the SIX/Sine oculis homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Homeobox protein SIX3 antibody
    • HPE2 antibody
    • Sine oculis homeobox homolog 3 antibody
    • SIX homeobox 3 antibody
    • Six3 antibody
    • SIX3_HUMAN antibody
    see all

Images

  • All lanes : Anti-Six3 antibody (ab172131) at 1 µg/ml

    Lane 1 : Six3 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.


    Predicted band size : 35 kDa

References

ab172131 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172131.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up