Overview

  • Product name
    Anti-SKA3 antibody - C-terminal
    See all SKA3 primary antibodies
  • Description
    Rabbit polyclonal to SKA3 - C-terminal
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Rhesus monkey, Gorilla
  • Immunogen

    Synthetic peptide within Human SKA3 aa 362-412 (C terminal). The exact sequence is proprietary. NP_659498
    Sequence:

    PEVTKIPEDILQLLSKYNSNLATPIAIKAVPPSKRFLKHGQNIRDVSNKE N


    Database link: Q8IX90

  • Positive control
    • HeLa, 293T or jurkat lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab186003 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 43 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function
    Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies. The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner. In the complex, it mediates the microtubule-stimulated oligomerization.
  • Sequence similarities
    Belongs to the SKA3 family.
  • Cellular localization
    Cytoplasm > cytoskeleton > spindle. Chromosome > centromere > kinetochore. Localizes to the outer kinetochore and spindle microtubules during mitosis in a NDC80 complex-dependent manner.
  • Information by UniProt
  • Database links
  • Alternative names
    • C13orf3 antibody
    • RAMA1 antibody
    • SKA3 antibody
    • SKA3_HUMAN antibody
    • Spindle and kinetochore associated complex subunit 3 antibody
    • Spindle and kinetochore-associated protein 3 antibody
    see all

Images

  • Detection of Human SKA3 by Western Blot of Immunoprecipitates. 1 mg for IP; 20% of IP Jurkat whole cell lysate loaded. ab186003 used for IP at 6µg/ml. For blotting immunoprecipitated SKA3, ab186003 was used at 1 µg/ml.

  • All lanes : Anti-SKA3 antibody - C-terminal (ab186003) at 0.1 µg/ml

    Lane 1 : HeLa lysate
    Lane 2 : 293T lysate
    Lane 3 : Jurkat lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique

    Predicted band size : 43 kDa


    Exposure time : 30 seconds

References

ab186003 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186003.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up