Overview

  • Product nameAnti-SLC22A14 antibody
    See all SLC22A14 primary antibodies
  • Description
    Rabbit polyclonal to SLC22A14
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Cat
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 144-194 (

    IIQFGLNDTDTCQDGWIYPDAKKRSLINEFDLVCGMETKKDTAQIMFMAG

    ) of Human SLC22A14 (NP_004794)

  • Positive control
    • MCF7 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab84063 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 67 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceSLC22A14 is a member of the organic-cation transporter family. SLC22A14 is a transmembrane protein which is thought to transport small molecules and since this protein is conserved among several species, it is suggested to have a fundamental role in mammalian systems. This gene encodes a member of the organic-cation transporter family.
  • Cellular localizationMembrane; Multi-pass membrane protein
  • Database links
  • Alternative names
    • MGC163415 antibody
    • OCTL2 antibody
    • OCTL4 antibody
    • ORCTL 4 antibody
    • ORCTL4 antibody
    • Organic cation transporter like 4 antibody
    • Organic cationic transporter like 4 antibody
    • SLC22A14 antibody
    • Solute carrier family 22 member 14 antibody
    see all

Anti-SLC22A14 antibody images

  • Anti-SLC22A14 antibody (ab84063) at 1 µg/ml (in 5% skim milk / PBS buffer) + MCF7 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 67 kDa
    Observed band size : 64 kDa (why is the actual band size different from the predicted?)

References for Anti-SLC22A14 antibody (ab84063)

ab84063 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84063.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"