Overview

  • Product nameAnti-Slc25a1 antibody
    See all Slc25a1 primary antibodies
  • Description
    Rabbit polyclonal to Slc25a1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 215-264 (NKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCG L) of Human Slc25a1 (NP_005975).

  • Positive control
    • Human fetal stomach lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab99168 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 34 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionInvolved in citrate-H(+)/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD(+) for the glycolytic pathway.
  • Sequence similaritiesBelongs to the mitochondrial carrier family.
    Contains 3 Solcar repeats.
  • Cellular localizationMitochondrion inner membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Citrate transport protein antibody
    • CTP antibody
    • mitochondrial antibody
    • SLC20A3 antibody
    • Slc25a1 antibody
    • solute carrier family 20 (mitochondrial citrate transporter), member 3 antibody
    • solute carrier family 25 (mitochondrial carrier; citrate transporter), member 1 antibody
    • Solute carrier family 25 member 1 antibody
    • Tricarboxylate carrier protein antibody
    • Tricarboxylate transport protein antibody
    • tricarboxylate transport protein, mitochondrial antibody
    • TXTP_HUMAN antibody
    see all

Anti-Slc25a1 antibody images

  • Anti-Slc25a1 antibody (ab99168) at 1 µg/ml + Human fetal stomach lysate at 10 µg

    Predicted band size : 34 kDa

References for Anti-Slc25a1 antibody (ab99168)

ab99168 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99168.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"