
  • Product name
  • Description
    Rabbit polyclonal to Slc25a1
  • Host species
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 215-264 (NKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCG L) of Human Slc25a1 (NP_005975).

  • Positive control
    • Human fetal stomach lysate



Our Abpromise guarantee covers the use of ab99168 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 34 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Function
    Involved in citrate-H(+)/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD(+) for the glycolytic pathway.
  • Sequence similarities
    Belongs to the mitochondrial carrier family.
    Contains 3 Solcar repeats.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Citrate transport protein antibody
    • CTP antibody
    • mitochondrial antibody
    • SLC20A3 antibody
    • Slc25a1 antibody
    • solute carrier family 20 (mitochondrial citrate transporter), member 3 antibody
    • solute carrier family 25 (mitochondrial carrier; citrate transporter), member 1 antibody
    • Solute carrier family 25 member 1 antibody
    • Tricarboxylate carrier protein antibody
    • Tricarboxylate transport protein antibody
    • tricarboxylate transport protein, mitochondrial antibody
    • TXTP_HUMAN antibody
    see all


  • Anti-Slc25a1 antibody (ab99168) at 1 µg/ml + Human fetal stomach lysate at 10 µg

    Predicted band size: 34 kDa

    Gel concentration: 12%


This product has been referenced in:
  • Admoni-Elisha L  et al. Novel Biomarker Proteins in Chronic Lymphocytic Leukemia: Impact on Diagnosis, Prognosis and Treatment. PLoS One 11:e0148500 (2016). Human . Read more (PubMed: 27078856) »

See 1 Publication for this product

Customer reviews and Q&As

Abcam has not validated the combination of species/application used in this Abreview.
Western blot
Mouse Tissue lysate - whole (Liver)
Gel Running Conditions
Reduced Denaturing (12% gel)
Loading amount
20 µg
Blocking step
Licor Odyssey Blocking Buffer as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Apr 11 2017

Abcam has not validated the combination of species/application used in this Abreview.
Western blot
Zebrafish Tissue lysate - whole (Retina)
Gel Running Conditions
Reduced Denaturing (12% gel)
Loading amount
20 µg
Blocking step
Licor Odyssey Blocking Buffer as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Apr 11 2017

Western blot
Human Cell lysate - whole cell (HEK cells)
Gel Running Conditions
Reduced Denaturing (12% gel)
Loading amount
20 µg
HEK cells
Blocking step
Licor Odyssey Blocking Buffer as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Apr 11 2017


Sign up