
  • Product name
  • Description
    Rabbit polyclonal to SLC25A38
  • Tested applications
    Suitable for: ELISA, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic human peptide derived from the following region: VGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTR .

  • Positive control
    • Jurkat cells. Skeletal muscle.



Our Abpromise guarantee covers the use of ab62224 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1:1562500.

WB Use a concentration of 0.25 µg/ml. Detects a band of approximately 34 kDa (predicted molecular weight: 34 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.


Anti-SLC25A38 antibody images

  • Anti-SLC25A38 antibody (ab62224) at 0.25 µg/ml + Jurkat cell lysate at 30 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 34 kDa
    Observed band size : 34 kDa
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human muscle tissue labelling SLC25A38 with ab62224 at 4-8µg/ml. Arrows indicate positively labelled skeletal muscle cells. Magnification: 400X.

References for Anti-SLC25A38 antibody (ab62224)

This product has been referenced in:
  • Chen H  et al. Overexpression of SLC25A38 protein on acute lymphoblastic leukemia cells. Oncol Lett 7:1422-1426 (2014). WB ; Human . Read more (PubMed: 24765149) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab62224.
Please use the links above to contact us or submit feedback about this product.


Sign up