
  • Product nameAnti-SLC25A38 antibody
    See all SLC25A38 primary antibodies
  • Description
    Rabbit polyclonal to SLC25A38
  • Tested applicationsSuitable for: ELISA, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic human peptide derived from the following region: VGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTR .

  • Positive control
    • Jurkat cells. Skeletal muscle.



Our Abpromise guarantee covers the use of ab62224 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1:1562500.

WB Use a concentration of 0.25 µg/ml. Detects a band of approximately 34 kDa (predicted molecular weight: 34 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.


Anti-SLC25A38 antibody images

  • Anti-SLC25A38 antibody (ab62224) at 0.25 µg/ml + Jurkat cell lysate at 30 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 34 kDa
    Observed band size : 34 kDa
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human muscle tissue labelling SLC25A38 with ab62224 at 4-8µg/ml. Arrows indicate positively labelled skeletal muscle cells. Magnification: 400X.

References for Anti-SLC25A38 antibody (ab62224)

This product has been referenced in:
  • Chen H  et al. Overexpression of SLC25A38 protein on acute lymphoblastic leukemia cells. Oncol Lett 7:1422-1426 (2014). WB ; Human . Read more (PubMed: 24765149) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab62224.
Please use the links above to contact us or submit feedback about this product.