Overview

  • Product nameAnti-SLC26A10 antibody
  • Description
    Rabbit polyclonal to SLC26A10
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 2 - 51 (RLDLASLMSAPKSLGSAFKSWRLDKAPSPQHTFPSTSIPGMAFALLASV P) of Human SLC26A10 (NP_597996)

  • Positive control
    • HepG2 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab86347 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 60 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-SLC26A10 antibody images

  • Anti-SLC26A10 antibody (ab86347) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 60 kDa
    Observed band size : 65 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 48 kDa (possible isoform).

References for Anti-SLC26A10 antibody (ab86347)

ab86347 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab86347.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"