Overview

  • Product name
  • Description
    Rabbit polyclonal to SLC26A6
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human SLC26A6 aa 1-758. Isoform 3. (NP_599025.2).
    Sequence:

    MGLADASGPRDTQALLSATQAMDLRRRDYHMERPLLNQEHLEELGRWGSA PRTHQWRTWLQCSRARAYALLLQHLPVLVWLPRYPVRDWLLGDLLSGLSV AIMQLPQGLAYALLAGLPPVFGLYSSFYPVFIYFLFGTSRHISVGTFAVM SVMVGSVTESLAPQALNDSMINETARDAARVQVASTLSVLVGLFQVGLGL IHFGFVVTYLSEPLVRGYTTAAAVQVFVSQLKYVFGLHLSSHSGPLSLIY TVLEVCWKLPQSKVGTVVTAAVAGVVLVVVKLLNDKLQQQLPMPIPGELL TLIGATGISYGMGLKHRFEVDVVGNIPAGLVPPVAPNTQLFSKLVGSAFT IAVVGFAIAISLGKIFALRHGYRVDSNQELVALGLSNLIGGIFQCFPVSC SMSRSLVQESTGGNSQVAGAISSLFILLIIVKLGELFHDLPKAVLAAIII VNLKGMLRQLSDMRSLWKANRADLLIWLVTFTATILLNLDLGLVVAVIFS LLLVVVRTQMPHYSVLGQVPDTDIYRDVAEYSEAKEVRGVKVFRSSATVY FANAEFYSDALKQRCGVDVDFLISQKKKLLKKQEQLKLKQLQKEEKLRKQ AASPKGASVSINVNTSLEDMRSNNVEDCKMMVSSGDKMEDATANGQEDSK APDGSTLKALGLPQPDFHSLILDLGALSFVDTVCLKSLKNIFHDFREIEV EVYMAACHSPVVSQLEAGHFFDASITKKHLFASVHDAVTFALQHPRPVPD SPVSVTRL


    Database link: Q9BXS9-3

  • Positive control
    • SLC26A6 transfected 293T cell line.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab172684 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 83 kDa.

Target

  • Function
    Does not seem to be involved in anion transport.
  • Tissue specificity
    Ubiquitous. Highest levels in kidney and pancreas. Lower expression in heart, skeletal muscle, liver and placenta. Also found in lung and brain.
  • Sequence similarities
    Belongs to the SLC26A/SulP transporter (TC 2.A.53) family.
    Contains 1 STAS domain.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Anion exchange transporter antibody
    • Anion transporter 1 antibody
    • DKFZp586E1422 antibody
    • Pendrin L1 antibody
    • Pendrin like protein 1 antibody
    • Pendrin-L1 antibody
    • Pendrin-like protein 1 antibody
    • S26A6_HUMAN antibody
    • SLC26A6 antibody
    • Solute carrier family 26 member 6 antibody
    • Sulfate anion transporter antibody
    see all

Images

  • All lanes : Anti-SLC26A6 antibody (ab172684) at 1 µg/ml

    Lane 1 : SLC26A6 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique

    Predicted band size : 83 kDa

References

ab172684 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172684.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up