
  • Product name
  • Description
    Rabbit polyclonal to SLC27A6
  • Host species
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within the middle amino acids 215-264 (KSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTAHDIVYITLP L) of Human SLC27A6 (NP_001017372)

  • Positive control
    • MCF7 membrane lysate



Our Abpromise guarantee covers the use of ab84183 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 70 kDa (predicted molecular weight: 70 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P 1/100.
ICC/IF Use a concentration of 5 µg/ml.


  • Function
    Involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. Thought to function as the predominant fatty acid protein transporter in heart.
  • Tissue specificity
    Strongly expressed in heart and localizes to cardiac myocytes. Expressed at moderate levels in placenta, testis, and adrenal glands. Expressed at very low levels in kidney, bladder and uterus.
  • Sequence similarities
    Belongs to the ATP-dependent AMP-binding enzyme family.
  • Cellular localization
    Membrane. Cell membrane > sarcolemma. In heart is exclusively located on the sarcolemma in areas juxtaposed with small blood vessels where it colocalizes CD36.
  • Information by UniProt
  • Database links
  • Alternative names
    • ACSVL2 antibody
    • FACVL2 antibody
    • FATP 6 antibody
    • FATP-6 antibody
    • FATP1 antibody
    • FATP6 antibody
    • Fatty acid coenzyme A ligase, very long chain 2 antibody
    • Fatty acid transport protein 6 antibody
    • Fatty-acid-coenzyme A ligase antibody
    • hVLCS H1 antibody
    • hVLCS-H1 antibody
    • Long-chain fatty acid transport protein 6 antibody
    • S27A6_HUMAN antibody
    • SLC27A6 antibody
    • solute carrier family 27 fatty acid transporter member 6 antibody
    • Solute carrier family 27 member 6 antibody
    • Very long chain acyl CoA synthetase homolog 1 antibody
    • very long-chain 2 antibody
    • Very long-chain acyl-CoA synthetase homolog 1 antibody
    • VLCS H1 antibody
    • VLCSH1 antibody
    see all


  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human pineal tissue labelling SLC27A6 with ab84183 at 1/100. A Cy3-conjugated donkey anti-rabbit IgG (1/200) was used as the secondary antibody. Positive staining shown in the membrane and cytoplasm of cell bodies of pinealocytes and their processes. Magnification: 20X. Exposure time: 0.5 - 2.0 seconds. Left - DAPI. Middle - SLC27A6. Right - Merge.
  • Anti-SLC27A6 antibody (ab84183) at 1 µg/ml + MCF7 membrane lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 70 kDa
    Observed band size: 70 kDa

  • ICC/IF image of ab84183 stained HeLa cells. The cells were 100% methanol fixed (5 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab84183, 5µg/ml) overnight at +4°C. The secondary antibody (green) was ab96899 Dylight 488 goat anti-rabbit IgG (H+L) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.


This product has been referenced in:
  • Gaccioli F  et al. Maternal overweight induced by a diet with high content of saturated fat activates placental mTOR and eIF2 alpha signaling and increases fetal growth in rats. Biol Reprod 89:96 (2013). Rat . Read more (PubMed: 24006279) »

See 1 Publication for this product

Customer reviews and Q&As

Thank you for contacting us.

I have spoken with the lab and arranged for a blocking control peptide to be placed in our product catalog. The product name and number areSLC27A6 peptide (ab125056), it may take a few days for that to becom...

Read More


Sign up