Overview

  • Product name
    Anti-SLC2A13 antibody
  • Description
    Rabbit polyclonal to SLC2A13
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide corresponding to Human SLC2A13 aa 248-278 (internal sequence) conjugated to Keyhole Limpet Haemocyanin (KLH).
    Sequence:

    PAVIQFFGFLFLPESPRWLIQKGQTQKARRI


    Database link: Q96QE2

  • Positive control
    • Human brain, cerebellum tissue; Mouse liver and kidney tissue lysates; Human uterus tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab190163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 70 kDa.Can be blocked with Human SLC2A13 peptide (ab232797).
IHC-P 1/100.

Target

  • Function
    H(+)-myo-inositol cotransporter. Can also transport related stereoisomers.
  • Tissue specificity
    Predominantly expressed in the brain.
  • Sequence similarities
    Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family.
  • Post-translational
    modifications
    Glycosylated.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • 6530403A04 antibody
    • A630029G22Rik antibody
    • AI505012 antibody
    • Gm308 antibody
    • H(+)-myo-inositol cotransporter antibody
    • H(+)-myo-inositol symporter antibody
    • Hmit antibody
    • MGC48624 antibody
    • MYCT_HUMAN antibody
    • Proton myo-inositol cotransporter antibody
    • Slc2a13 antibody
    • Solute carrier family 2 (facilitated glucose transporter), member 13 antibody
    see all

Images

  • Immunohistochemical staining of Human brain, cerebellum tissue labeling SLC2A13 using ab190163 at 1/100 dilution.

  • Anti-SLC2A13 antibody (ab190163) at 1/1000 dilution + Human uterus tissue lysate at 35 µg

    Predicted band size: 70 kDa

  • All lanes : Anti-SLC2A13 antibody (ab190163) at 1/1000 dilution

    Lane 1 : Mouse liver tissue lysate
    Lane 2 : Mouse kidney tissue lysate

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 70 kDa

References

ab190163 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190163.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up