Anti-SLC34A1 antibody - N-terminal (ab182099)

Overview

  • Product name
    Anti-SLC34A1 antibody - N-terminal
    See all SLC34A1 primary antibodies
  • Description
    Rabbit polyclonal to SLC34A1 - N-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Sheep, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human, Pig
  • Immunogen

    Synthetic peptide within Rat SLC34A1 aa 31-80 (N terminal). The exact sequence is proprietary.
    Sequence:

    YVPSPQVLHRIPGTTTYAISSLSPVALTEHSCPYGEVLECHDPLPAKLAQ


    Database link: Q06496

  • Positive control
    • Rat thymus lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab182099 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 69 kDa.

Target

  • Relevance
    May be involved in actively transporting phosphate into cells via Na+ cotransport in the renal brush border membrane. Probably mediates 70-80% of the apical influx.
  • Cellular localization
    Membrane; Multi-pass membrane protein.
  • Database links
  • Alternative names
    • FRTS2 antibody
    • Na(+)-dependent phosphate cotransporter 2A antibody
    • Na(+)/Pi cotransporter 2A antibody
    • Na+-phosphate cotransporter type II antibody
    • naPi-2a antibody
    • NAPI-3 antibody
    • naPi2a antibody
    • NAPI3 antibody
    • NPHLOP1 antibody
    • NPT2 antibody
    • NPTIIa antibody
    • renal sodium-dependent phosphate transporter antibody
    • renal sodium/phosphate transporter protein 2 antibody
    • SLC11 antibody
    • SLC17A2 antibody
    • SLC17A2, formerly antibody
    • sodium-dependent phosphate transport protein 2A antibody
    • sodium-phosphate transport protein 2A antibody
    • sodium/phosphate co-transporter antibody
    • sodium/phosphate cotransporter 2A antibody
    • sodium/phosphate transporter 2, kidney antibody
    • solute carrier family 17 (sodium phosphate), member 2 antibody
    • solute carrier family 17, member 2, formerly antibody
    • solute carrier family 34 (sodium phosphate), member 1 antibody
    • solute carrier family 34 (type II sodium/phosphate contransporter), member 1 antibody
    • solute carrier family 34 member 1 antibody
    see all

Images

  • Anti-SLC34A1 antibody - N-terminal (ab182099) at 1 µg/ml + rat thymus lysate at 10 µg

    Predicted band size : 69 kDa

References

ab182099 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

According to uniprot (http://www.uniprot.org/uniprot/Q06495) SLC34A1 has two isofroms at 69 and 37 kDa. This explains why the protein can show up at either molecular weight depending on what isoforms are present.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up