Overview

  • Product name
  • Description
    Rabbit polyclonal to SLC34A3
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within amino acids 180-229 (

    GDRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATALLERLSELALGAASL

    ) of Human SLC34A3 (NP_543153)

  • Positive control
    • Human fetal lung lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab83093 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 63 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    May be involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane. Probably mediates 20-30% of the apical influx.
  • Involvement in disease
    Hereditary hypophosphatemic rickets with hypercalciuria
  • Sequence similarities
    Belongs to the SLC34A transporter family.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • HHRH antibody
    • Na(+) dependent phosphate cotransporter 2C antibody
    • Na(+) Pi cotransporter 2C antibody
    • Na(+)-dependent phosphate cotransporter 2C antibody
    • Na(+)/Pi cotransporter 2C antibody
    • NaPi 2c antibody
    • NaPi-2c antibody
    • NPT2C antibody
    • NPT2C_HUMAN antibody
    • NPTIIC antibody
    • SLC34A3 antibody
    • Sodium dependent phosphate transport protein 2C antibody
    • Sodium inorganic phosphate cotransporter IIC antibody
    • Sodium phosphate cotransporter 2C antibody
    • Sodium phosphate transport protein 2C antibody
    • Sodium-dependent phosphate transport protein 2C antibody
    • Sodium-phosphate transport protein 2C antibody
    • Sodium/inorganic phosphate cotransporter IIC antibody
    • Sodium/inorganic phosphate cotransporter, type IIC antibody
    • Sodium/phosphate cotransporter 2C antibody
    • solute carrier family 34 (sodium phosphate) member 3 antibody
    • solute carrier family 34 (sodium/phosphate contransporter), member 3 antibody
    • solute carrier family 34 (type II sodium/phosphate contransporter), member 3 antibody
    • Solute carrier family 34 member 3 antibody
    • type IIc Na+ Pi cotransporter antibody
    • Type IIc Na+/Pi cotransporter antibody
    see all

Images

  • Anti-SLC34A3 antibody (ab83093) at 1 µg/ml + Human fetal lung lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 63 kDa
    Observed band size : 63 kDa

References

ab83093 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab83093.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up