Overview

  • Product nameAnti-SLC34A3 antibody
    See all SLC34A3 primary antibodies
  • Description
    Rabbit polyclonal to SLC34A3
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 215 - 264 (

    LLERLSELALGAASLTPRAQAPDILKVLTKPLTHLIVQLDSDMIMSSATG

    ) of Human SLC34A3 (NP_543153).

  • Positive control
    • COLO205 cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab97839 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 63 kDa.Can be blocked with SLC34A3 peptide (ab170967). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay be involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane. Probably mediates 20-30% of the apical influx.
  • Involvement in diseaseHereditary hypophosphatemic rickets with hypercalciuria
  • Sequence similaritiesBelongs to the SLC34A transporter family.
  • Cellular localizationMembrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • HHRH antibody
    • Na(+) dependent phosphate cotransporter 2C antibody
    • Na(+) Pi cotransporter 2C antibody
    • Na(+)-dependent phosphate cotransporter 2C antibody
    • Na(+)/Pi cotransporter 2C antibody
    • NaPi 2c antibody
    • NaPi-2c antibody
    • NPT2C antibody
    • NPT2C_HUMAN antibody
    • NPTIIC antibody
    • SLC34A3 antibody
    • Sodium dependent phosphate transport protein 2C antibody
    • Sodium inorganic phosphate cotransporter IIC antibody
    • Sodium phosphate cotransporter 2C antibody
    • Sodium phosphate transport protein 2C antibody
    • Sodium-dependent phosphate transport protein 2C antibody
    • Sodium-phosphate transport protein 2C antibody
    • Sodium/inorganic phosphate cotransporter IIC antibody
    • Sodium/inorganic phosphate cotransporter, type IIC antibody
    • Sodium/phosphate cotransporter 2C antibody
    • solute carrier family 34 (sodium phosphate) member 3 antibody
    • solute carrier family 34 (sodium/phosphate contransporter), member 3 antibody
    • solute carrier family 34 (type II sodium/phosphate contransporter), member 3 antibody
    • Solute carrier family 34 member 3 antibody
    • type IIc Na+ Pi cotransporter antibody
    • Type IIc Na+/Pi cotransporter antibody
    see all

Anti-SLC34A3 antibody images

  • Anti-SLC34A3 antibody (ab97839) at 1 µg/ml (in 5% skim milk / PBS buffer) + COLO205 cell lysate at 10 µg

    Secondary
    HRP-conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 63 kDa

References for Anti-SLC34A3 antibody (ab97839)

ab97839 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab97839.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"