Overview

  • Product name
  • Description
    Rabbit polyclonal to SLC34A3
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 215 - 264 (

    LLERLSELALGAASLTPRAQAPDILKVLTKPLTHLIVQLDSDMIMSSATG

    ) of Human SLC34A3 (NP_543153).

  • Positive control
    • COLO205 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab97839 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 63 kDa.Can be blocked with SLC34A3 peptide (ab170967). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    May be involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane. Probably mediates 20-30% of the apical influx.
  • Involvement in disease
    Hereditary hypophosphatemic rickets with hypercalciuria
  • Sequence similarities
    Belongs to the SLC34A transporter family.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • HHRH antibody
    • Na(+) dependent phosphate cotransporter 2C antibody
    • Na(+) Pi cotransporter 2C antibody
    • Na(+)-dependent phosphate cotransporter 2C antibody
    • Na(+)/Pi cotransporter 2C antibody
    • NaPi 2c antibody
    • NaPi-2c antibody
    • NPT2C antibody
    • NPT2C_HUMAN antibody
    • NPTIIC antibody
    • SLC34A3 antibody
    • Sodium dependent phosphate transport protein 2C antibody
    • Sodium inorganic phosphate cotransporter IIC antibody
    • Sodium phosphate cotransporter 2C antibody
    • Sodium phosphate transport protein 2C antibody
    • Sodium-dependent phosphate transport protein 2C antibody
    • Sodium-phosphate transport protein 2C antibody
    • Sodium/inorganic phosphate cotransporter IIC antibody
    • Sodium/inorganic phosphate cotransporter, type IIC antibody
    • Sodium/phosphate cotransporter 2C antibody
    • solute carrier family 34 (sodium phosphate) member 3 antibody
    • solute carrier family 34 (sodium/phosphate contransporter), member 3 antibody
    • solute carrier family 34 (type II sodium/phosphate contransporter), member 3 antibody
    • Solute carrier family 34 member 3 antibody
    • type IIc Na+ Pi cotransporter antibody
    • Type IIc Na+/Pi cotransporter antibody
    see all

Images

  • Anti-SLC34A3 antibody (ab97839) at 1 µg/ml (in 5% skim milk / PBS buffer) + COLO205 cell lysate at 10 µg

    Secondary
    HRP-conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 63 kDa

References

ab97839 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Intestine)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Dako retrieval solution (pH9)
Permeabilization
No
Specification
Intestine
Blocking step
Serum as blocking agent for 45 minute(s) · Concentration: 10% · Temperature: 22°C
Fixative
Formaldehyde
Username

Abcam user community

Verified customer

Submitted Aug 04 2017

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up