Overview

  • Product name
    Anti-SLC35C2 antibody
  • Description
    Rabbit polyclonal to SLC35C2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Human, Pig, Saccharomyces cerevisiae, Zebrafish
  • Immunogen

    Synthetic peptide within Mouse SLC35C2 aa 234-283. The exact sequence is proprietary.
    Sequence:

    QDTGLLLWVLGSLLLGGILAFGLGFSEFLLVSRTSSLTLSIAGIFKEVCT


    Database link: Q8VCX2

  • Positive control
    • Mouse liver lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab187097 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 40 kDa.

Target

Images

  • Anti-SLC35C2 antibody (ab187097) at 1 µg/ml + Mouse liver lysates at 10 µg

    Predicted band size: 40 kDa

References

ab187097 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187097.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up