Overview

  • Product name
    Anti-SLC35E2 antibody
  • Description
    Rabbit polyclonal to SLC35E2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 215-264 (

    AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP

    ) of Human SLC35E2 (NP_878258).

  • Positive control
    • COLO205 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab102033 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 44 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance
    SLC35E2 may function as a putative transporter.
  • Cellular localization
    Membrane; Multi-pass membrane protein
  • Database links
  • Alternative names
    • DKFZp686M0869 antibody
    • FLJ34996 antibody
    • FLJ44537 antibody
    • KIAA0447 antibody
    • MGC104754 antibody
    • MGC117254 antibody
    • MGC126715 antibody
    • MGC138494 antibody
    • Solute carrier family 35 member E2 antibody
    see all

Images

  • Anti-SLC35E2 antibody (ab102033) at 1 µg/ml + COLO205 Cell Lysate at 10 µg

    Predicted band size : 44 kDa

References

ab102033 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab102033.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up