Overview

  • Product nameAnti-SLC35E2 antibody
  • Description
    Rabbit polyclonal to SLC35E2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 215-264 (

    AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP

    ) of Human SLC35E2 (NP_878258).

  • Positive control
    • COLO205 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab102033 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 44 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceSLC35E2 may function as a putative transporter.
  • Cellular localizationMembrane; Multi-pass membrane protein
  • Database links
  • Alternative names
    • DKFZp686M0869 antibody
    • FLJ34996 antibody
    • FLJ44537 antibody
    • KIAA0447 antibody
    • MGC104754 antibody
    • MGC117254 antibody
    • MGC126715 antibody
    • MGC138494 antibody
    • Solute carrier family 35 member E2 antibody
    see all

Anti-SLC35E2 antibody images

  • Anti-SLC35E2 antibody (ab102033) at 1 µg/ml + COLO205 Cell Lysate at 10 µg

    Predicted band size : 44 kDa

References for Anti-SLC35E2 antibody (ab102033)

ab102033 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102033.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"