Overview

  • Product nameAnti-SLC35F3 antibody
    See all SLC35F3 primary antibodies
  • Description
    Rabbit polyclonal to SLC35F3
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 365-414 (

    IGLGFLLLLLPEEWDVWLIKLLTRLKVRKKEETAESSGDLGTGPQSRSRR

    ) of Mouse SLC35F3 (NP_780643).

  • Positive control
    • Mouse small intestine lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab113836 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 47 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionPutative solute transporter.
  • Sequence similaritiesBelongs to the SLC35F solute transporter family.
  • Cellular localizationMembrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • B230375D17Rik antibody
    • FLJ37712 antibody
    • MGC141263 antibody
    • MGC141264 antibody
    • OTTHUMP00000036032 antibody
    • OTTHUMP00000059757 antibody
    • S35F3_HUMAN antibody
    • SLC35F3 antibody
    • Solute carrier family 35 member F3 antibody
    • Solute carrier family 35, member F3 antibody
    see all

Anti-SLC35F3 antibody images

  • Anti-SLC35F3 antibody (ab113836) at 1 µg/ml + Mouse small intestine lysate at 10 µg

    Predicted band size : 47 kDa

References for Anti-SLC35F3 antibody (ab113836)

ab113836 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113836.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"