Overview

  • Product name
    Anti-SLC36A4 antibody
  • Description
    Rabbit Polyclonal to SLC36A4
  • Tested applications
    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SLC36A4 aa 15-77 (internal sequence).
    Sequence:

    REELDMDVMRPLINEQNFDGTSDEEHEQELLPVQKHYQLDDQEGISFVQT LMHLLKGNIGTGL


    Database link: Q6YBV0

  • Positive control
    • Human hippocampus tissue.
  • General notes

    Affinity purified using the PrEST antigen as affinity ligand.

Properties

Applications

Our Abpromise guarantee covers the use of ab121540 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Functions as a sodium-independent electroneutral transporter for tryptophan, proline and alanine. Inhibited by sarcosine.
  • Sequence similarities
    Belongs to the amino acid/polyamine transporter 2 family.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • PAT4 antibody
    • Proton-coupled amino acid transporter 4 antibody
    • Proton/amino acid transporter 4 antibody
    • S36A4_HUMAN antibody
    • Slc36a4 antibody
    • Solute carrier family 36 member 4 antibody
    see all

Anti-SLC36A4 antibody images

  • Immunofluorescent staining of Human cell line U-2 OS shows positivity in plasma membrane, golgi apparatus and vesicles. Recommended concentration of ab121540 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab121540 at 1/500 dilution staining SLC36A4 in paraffin-embedded Human hippocampus tissue by Immunohistochemistry.

References for Anti-SLC36A4 antibody (ab121540)

ab121540 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab121540.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up