Overview

  • Product nameAnti-SLC39A2 antibody
    See all SLC39A2 primary antibodies
  • Description
    Rabbit polyclonal to SLC39A2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 71-120 (

    EIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFFVFFLE

    ) of Human SLC39A2 (NP_055394).

  • Positive control
    • PANC1 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab99071 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 33 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMediates zinc uptake. Zinc uptake may be mediated by a Zn(2+)-HCO(3)(-) symport mechanism and can function in the presence of albumin. May also transport other divalent cations. May be important in contact inhibition of normal epithelial cells and loss of its expression may play a role in tumorigenesis.
  • Tissue specificityExpressed only in prostate and uterine epithelial cells.
  • Sequence similaritiesBelongs to the ZIP transporter (TC 2.A.5) family.
  • Cellular localizationCell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • hZIP2 antibody
    • 6A1 antibody
    • Eti-1 antibody
    • Eti1 antibody
    • hZIP2 antibody
    • MGC119190 antibody
    • OTTHUMP00000164402 antibody
    • S39A2_HUMAN antibody
    • SLC39A2 antibody
    • Solute carrier family 39 (zinc transporter) member 2 antibody
    • Solute carrier family 39 member 2 antibody
    • Zinc transporter ZIP2 antibody
    • ZIP 2 antibody
    • ZIP-2 antibody
    • ZIP2 antibody
    • Zrt and Irt like protein 2 antibody
    • Zrt- and Irt-like protein 2 antibody
    see all

Anti-SLC39A2 antibody images

  • Anti-SLC39A2 antibody (ab99071) at 1/1 dilution + PANC1 cell lysate at 10 µg

    Predicted band size : 33 kDa

References for Anti-SLC39A2 antibody (ab99071)

This product has been referenced in:
  • Franz MC  et al. Development of the First Fluorescence Screening Assay for the SLC39A2 Zinc Transporter. J Biomol Screen N/A:N/A (2014). Human . Read more (PubMed: 24619115) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab99071.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"