Overview

  • Product nameAnti-SLC39A7 antibody
    See all SLC39A7 primary antibodies
  • Description
    Rabbit polyclonal to SLC39A7
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Sheep, Rabbit, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 107-156 (

    HDHEHSHGGYGESGAPGIKQDLDAVTLWAYALGATVLISAAPFFVLFLIP

    ) of Human SLC39A7 (NP_001070984)

  • Positive control
    • MCF7 cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab84179 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 50 kDa (predicted molecular weight: 50 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Tissue specificityMajor expression in placenta, lung, kidney and pancreas.
  • Sequence similaritiesBelongs to the ZIP transporter (TC 2.A.5) family. KE4/Catsup subfamily.
  • Cellular localizationMembrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • D6S115E antibody
    • D6S2244E antibody
    • H2 KE4 antibody
    • Histidine rich membrane protein Ke4 antibody
    • Histidine-rich membrane protein Ke4 antibody
    • HKE4 antibody
    • HLA class II region expressed gene KE4 antibody
    • KE4 antibody
    • Ke4 gene mouse, human homolog of antibody
    • Really interesting new gene 5 protein antibody
    • RING5 antibody
    • S39A7_HUMAN antibody
    • SLC39A7 antibody
    • Solute carrier family 39 (zinc transporter), member 7 antibody
    • Solute carrier family 39 member 7 antibody
    • solute carrier family 39 zinc transporter member 7 antibody
    • Zinc transporter SLC39A7 antibody
    • ZIP7 antibody
    see all

Anti-SLC39A7 antibody images

  • Anti-SLC39A7 antibody (ab84179) at 1 µg/ml + MCF7 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 50 kDa
    Observed band size : 50 kDa

References for Anti-SLC39A7 antibody (ab84179)

ab84179 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84179.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"