Overview

  • Product nameAnti-SLC39A9 antibody
    See all SLC39A9 primary antibodies
  • Description
    Rabbit polyclonal to SLC39A9
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Horse, Chicken, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 107-156 (

    YIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAARSSNSKITTTLGLVVHA

    ) of Human SLC39A9 (NP_060845).

  • Positive control
    • U937 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab102030 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 32 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay act as a zinc-influx transporter.
  • Sequence similaritiesBelongs to the ZIP transporter (TC 2.A.5) family.
  • Cellular localizationMembrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ11274 antibody
    • MGC74989 antibody
    • PRO1377 antibody
    • S39A9_HUMAN antibody
    • SLC39A9 antibody
    • Solute carrier family 39 (zinc transporter), member 9 antibody
    • Solute carrier family 39 member 9 antibody
    • UNQ714 antibody
    • Zinc transporter SLC39A9 antibody
    • Zinc transporter ZIP9 antibody
    • ZIP 9 antibody
    • ZIP-9 antibody
    • ZIP9 antibody
    • Zrt- and Irt-like protein 9 antibody
    see all

Anti-SLC39A9 antibody images

  • Anti-SLC39A9 antibody (ab102030) at 1 µg/ml + U937 Cell Lysate at 10 µg

    Predicted band size : 32 kDa

References for Anti-SLC39A9 antibody (ab102030)

ab102030 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102030.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"