Overview

  • Product name
  • Description
    Rabbit polyclonal to SLC39A9
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Horse, Chicken, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 107-156 (

    YIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAARSSNSKITTTLGLVVHA

    ) of Human SLC39A9 (NP_060845).

  • Positive control
    • U937 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab102030 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 32 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    May act as a zinc-influx transporter.
  • Sequence similarities
    Belongs to the ZIP transporter (TC 2.A.5) family.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ11274 antibody
    • MGC74989 antibody
    • PRO1377 antibody
    • S39A9_HUMAN antibody
    • SLC39A9 antibody
    • Solute carrier family 39 (zinc transporter), member 9 antibody
    • Solute carrier family 39 member 9 antibody
    • UNQ714 antibody
    • Zinc transporter SLC39A9 antibody
    • Zinc transporter ZIP9 antibody
    • ZIP 9 antibody
    • ZIP-9 antibody
    • ZIP9 antibody
    • Zrt- and Irt-like protein 9 antibody
    see all

Images

  • Anti-SLC39A9 antibody (ab102030) at 1 µg/ml + U937 Cell Lysate at 10 µg

    Predicted band size : 32 kDa

References

ab102030 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab102030.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up