Overview

  • Product name
  • Description
    Rabbit polyclonal to SLC41A3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SLC41A3 aa 1-62.
    Sequence:

    MDGTETRQRRLDSCGKPGELGLPHPLSTGGLPVASEDGALRAPESQSVTP KPLETEPSRETT


    Database link: Q96GZ6

  • Positive control
    • RT 4 and U 251MG cell line lysates, Human cerebral cortex tissue, U 2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab185122 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.
WB 1/1000 - 1/2500. Predicted molecular weight: 55 kDa.

Target

  • Relevance
    SLC41A3 belongs to the SLC41A transporter family. The exact function of SLC41A3 remains unknown.
  • Cellular localization
    Cell membrane; Multi-pass membrane protein.
  • Database links
  • Alternative names
    • 1010001P06Rik antibody
    • AI480742 antibody
    • FLJ20473 antibody
    • OTTMUSP00000028993 antibody
    • OTTMUSP00000028994 antibody
    • SLC41A1 L2 antibody
    • SLC41A1 like 2 antibody
    • Solute carrier family 41, member 3 antibody
    see all

Images

  • Immunofluorescent analysis of Human cell line U2 OS (Fixation/Permeabilization: PFA/Triton X-100) labeling SLC41A3 with ab185122 at 4 µg/ml.

  • Immunohistochemical analysis of  Human cerebral cortex labeling SLC41A3 with ab185122 at 1/1000.

  • All lanes : Anti-SLC41A3 antibody (ab185122) at 1/1000 dilution

    Lane 1 : RT 4 cell line lysate
    Lane 2 : U 251MG cell line lysate

    Predicted band size: 55 kDa


    Exposure time: 1 minute

References

ab185122 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185122.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up