Overview

  • Product name
    Anti-SLCO6A1 antibody
  • Description
    Rabbit polyclonal to SLCO6A1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SLCO6A1 aa 530-580.
    Sequence:

    AGCTYSKAQNQKKMYYNCSCIKEGLITADAEGDFIDARPGKCDAKCYKLP L


    Database link: Q86UG4

  • Positive control
    • Human testis tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab185501 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance
    The function of SLCO6A1 (solute carrier organic anion transporter family, member 6A1) is currently unknown.
  • Cellular localization
    Membrane; Multi-pass membrane protein
  • Database links
  • Alternative names
    • Cancer/testis antigen 48 antibody
    • CT48 antibody
    • Gonad specific transporter antibody
    • GST antibody
    • MGC26949 antibody
    • OATP I antibody
    • OATP6A1 antibody
    • OATPY antibody
    • Organic anion transporting polypeptide 6A1 antibody
    • Organic anion transporting polypeptide I antibody
    • SLC21A19 antibody
    • Solute carrier family 21 member 19 antibody
    • Solute carrier organic anion transporter family member 6A1 antibody
    • Testis specific organic anion transporter antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human testis tissue labeling SLCO6A1 with ab185501 at 1/50 dilution.

References

ab185501 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185501.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up