Overview

  • Product name
  • Description
    Rabbit polyclonal to SLFN12
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 35-84 (

    KLRKKQNESVSRAMCALLNSGGGVIKAEIENEDYSYTKDGIGLDLENSFS

    ) of Human SLFN12 (NP_060512).

  • Positive control
    • Human fetal stomach cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab99200 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 67 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-SLFN12 antibody images

  • Anti-SLFN12 antibody (ab99200) at 1 µg/ml + Human fetal stomach lysate at 10 µg

    Predicted band size : 67 kDa

References for Anti-SLFN12 antibody (ab99200)

ab99200 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99200.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up