Overview

  • Product nameAnti-SLFN12 antibody
    See all SLFN12 primary antibodies
  • Description
    Rabbit polyclonal to SLFN12
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 35-84 (

    KLRKKQNESVSRAMCALLNSGGGVIKAEIENEDYSYTKDGIGLDLENSFS

    ) of Human SLFN12 (NP_060512).

  • Positive control
    • Human fetal stomach cell lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG

Applications

Our Abpromise guarantee covers the use of ab99200 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 67 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-SLFN12 antibody images

  • Anti-SLFN12 antibody (ab99200) at 1 µg/ml + Human fetal stomach lysate at 10 µg

    Predicted band size : 67 kDa

References for Anti-SLFN12 antibody (ab99200)

ab99200 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99200.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"