Overview

  • Product name
    Anti-SLTM antibody
  • Description
    Rabbit polyclonal to SLTM
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SLTM aa 71-181.
    Sequence:

    STDTPNKKPTKGKGKKHEADELSGDASVEDDAFIKDCELENQEAHEQDGN DELKDSEEFGENEEENVHSKELLSAEENKRAHELIEAEGIEDIEKEDIES QEIEAQEGEDD


    Database link: Q9NWH9

  • Positive control
    • Human bone marrow tissue; U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204445 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance
    When SLTM is overexpressed it acts as a general inhibitor of transcription that eventually leads to apoptosis.
  • Cellular localization
    Nuclear. Note: Detected in punctate structures.
  • Database links
  • Alternative names
    • DKFZp762G052 antibody
    • FLJ10005 antibody
    • FLJ13213 antibody
    • MET antibody
    • Modulator of estrogen induced transcription antibody
    • SAFB like transcription modulator antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling SLTM with ab204445 at 4 µg/ml (green).

  • Immunohistochemical analysis of paraffin-embedded Human bone marrow tissue labeling SLTM with ab204445 at 1/200 dilution.

References

ab204445 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204445.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up