Overview

  • Product nameAnti-Smek1 antibody
    See all Smek1 primary antibodies
  • Description
    Rabbit polyclonal to Smek1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 624-673 (YWKALEDVDYVQTFKGLKLRFEQQRERQDNPKLDSMRSILRNHRYRRDA R) of Human Smek1 (NP_115949).

  • Positive control
    • HeLa cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab102096 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 94 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionRegulatory subunit of serine/threonine-protein phosphatase 4. May regulate the activity of PPP4C at centrosomal microtubule organizing centers. The PPP4C-PPP4R2-PPP4R3A PP4 complex specifically dephosphorylates H2AFX phosphorylated on 'Ser-140' (gamma-H2AFX) generated during DNA replication and required for DNA DSB repair.
  • Sequence similaritiesBelongs to the SMEK family.
    Contains 1 WH1 domain.
  • Cellular localizationCytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Nucleus. In interphase localized in the cytoplasm and in the nucleus (with higher levels). During metaphase located in pericentriolar regions.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLFL1 antibody
    • KIAA2010 antibody
    • MEK1 SUPPRESSOR 1 antibody
    • MSTP033 antibody
    • P4R3A_HUMAN antibody
    • PP4R3 ALPHA antibody
    • PP4R3A antibody
    • PPP4R3A antibody
    • PROTEIN PHOSPHATASE 4, REGULATORY SUBUNIT 3, ALPHA antibody
    • Serine/threonine-protein phosphatase 4 regulatory subunit 3A antibody
    • SMEK homolog 1 antibody
    • SMEK homolog 1, suppressor of mek1 (Dictyostelium) antibody
    • smek1 antibody
    • SMK1 antibody
    see all

Anti-Smek1 antibody images

  • Anti-Smek1 antibody (ab102096) at 1 µg/ml + HeLa cell lysate at 10 µg

    Predicted band size : 94 kDa

References for Anti-Smek1 antibody (ab102096)

ab102096 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102096.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"