Overview

  • Product name
  • Description
    Rabbit polyclonal to Smoothelin
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human Smoothelin aa 433-517.
    Sequence:

    PVARSEEPGAPLPVAVGTAEPGGSMKTTFTIEIKDGRGQASTGRVLLPTG NQRAELTLGLRAPPTLLSTSSGGKSTITRVNSPGT


    Database link: P53814

  • Positive control
    • Human smooth muscle tissue, RT-4 cell lysate, A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204603 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 99 kDa.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

Images

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human smooth muscle tissue labeling Smoothelin with ab204603 at 1/1000.

  • Immunofluorescent analysis of paraformaldehyde fixed, Triton X-100 permeabilized A431 cells labeling Smoothelin with ab204603 at 4µg/ml (green).

  • Anti-Smoothelin antibody (ab204603) at 1/500 dilution + RT-4 cell lysate

    Predicted band size: 99 kDa

References

ab204603 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204603.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up