Overview

  • Product nameAnti-SMTNL1 antibody
    See all SMTNL1 primary antibodies
  • Description
    Rabbit polyclonal to SMTNL1
  • Tested applicationsSuitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    antigen sequence: EETKGTAGKAINEGPPTESGKQEKAPAEDGMSAELQGEANGLDEVKVESQ REAGGKEDAE AELKKEDGEKEETTVGSQEMTGRKE, corresponding to N terminal amino acids 32-116 of Human SMTNL1. (A8MU46)

  • Positive control
    • Human rectum tissue

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab122645 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • RelevancePlays a role in the regulation of contractile properties of both striated and smooth muscles. When unphosphorylated, may inhibit myosin dephosphorylation. Phosphorylation at Ser-299 reduces this inhibitory activity.
  • Cellular localizationCytoplasm › myofibril. Cytoplasm › myofibril › sarcomere › I band By similarity. Cytoplasm › myofibril › sarcomere › M line. Nucleus. Note: Colocalizes with MYH2. In its unphosphorylated state, localizes to the cytoplasm. Phosphorylation at Ser-301 promotes translocation to the nucleus
  • Database links
  • Alternative names
    • Calponin homology associated smooth muscle protein antibody
    • CHASM antibody
    • OTTHUMP00000235021 antibody
    • Smoothelin like 1 antibody
    • Smoothelin like protein 1 antibody
    • SMTNL1 antibody
    see all

Anti-SMTNL1 antibody images

  • ab122645, at 1/500, staining SMTNL1 in paraffin embedded Human rectum tissue by Immunohistochemistry.

References for Anti-SMTNL1 antibody (ab122645)

ab122645 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122645.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"