Anti-SNAIL + SLUG antibody (ab167609)
Key features and details
- Mouse polyclonal to SNAIL + SLUG
- Suitable for: WB, ICC/IF
- Reacts with: Human, Recombinant fragment
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-SNAIL + SLUG antibody
See all SNAIL + SLUG primary antibodies -
Description
Mouse polyclonal to SNAIL + SLUG -
Host species
Mouse -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human, Recombinant fragment
Predicted to work with: Chimpanzee, Rhesus monkey, Gorilla, Orangutan -
Immunogen
Recombinant full length protein aa 1-264. Corresponding to Human SNAIL.
Sequence:MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL NPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGS QPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQA RKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVR THTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSL LHKHQESGCSGCPR
Database link: NP_005976.2 -
Positive control
- SNAIl transfected 293T cell lysate. HeLa cells.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.4
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab167609 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa.
|
|
ICC/IF |
Use a concentration of 10 µg/ml.
|
Notes |
---|
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa. |
ICC/IF
Use a concentration of 10 µg/ml. |
Target
-
Relevance
Function: SNAIL is involved in the epithelial to mesenchymal transition (EMT) and formation and maintenance of embryonic mesoderm (By similarity). Binds to 3 E-boxes of the E-cadherin gene promoter and represses its transcription. SLUG is a transcriptional repressor, involved in the generation and migration of neural crest cells. PTM: SNAIL is phosphorylated by GSK3B. Once phosphorylated, it becomes a target for BTRC ubiquitination. Ubiquitinated on Lys-98, Lys-137 and Lys-146 by FBXL14 and BTRC leading to degradation. BTRC-triggered ubiquitination requires previous GSK3B-mediated SNAI1 phosphorylation. Similarity: Both SNAIL and SLUG belong to the snail C2H2-type zinc-finger protein family. Tissue specificity: SNAIL is expressed in a variety of tissues with the highest expression in kidney. Expressed in mesenchymal and epithelial cell lines. SLUG is expressed in placenta and adult heart, pancreas, liver, kidney and skeletal muscle. -
Cellular localization
Slug is generally nuclear, while Snail is known to be both cytoplasmic and nuclear. Once phosphorylated (probably on Ser-107, Ser-111, Ser-115 and Ser-119) snail is exported from the nucleus to the cytoplasm where subsequent phosphorylation of the destruction motif and ubiquitination involving BTRC occurs. -
Database links
- Entrez Gene: 6591 Human
- Entrez Gene: 6615 Human
- Omim: 604238 Human
- SwissProt: O43623 Human
- SwissProt: O95863 Human
-
Alternative names
- dJ710H13.1 antibody
- MGC10182 antibody
- Neural crest transcription factor Slug antibody
see all
Images
-
All lanes : Anti-SNAIL + SLUG antibody (ab167609) at 1 µg/ml
Lane 1 : SNAIL transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Secondary
All lanes : Goat anti-Mouse IgG
Predicted band size: 29 kDa -
Immunofluorescent analysis of HeLa cells labeling SNAIL with ab167609 at 10 µg/ml.
-
Lane 1 : Monoclonal Mouse anti-GST at 1 µg
Lanes 2 & 5 : Milk at 5 %
Lane 3 : Anti-SNAIL + SLUG antibody (ab167609) at 1 µg
Lane 4 : Monoclonal Mouse anti-GST at 1 µg/ml
Lane 6 : Anti-SNAIL + SLUG antibody (ab167609) at 1 µg/ml
Lanes 1-3 : SNAIL-GST fusion protein
Lanes 4-6 : SLUG-GST-fusion protein
Lysates/proteins at 0.2 µg per lane.
Secondary
All lanes : HRP conjugated Goat anti-mouse at 1/5000 dilution
Predicted band size: 29 kDa
Additional bands at: 55.5 kDa (possible tagged protein), 56.4 kDa (possible tagged protein)
Exposure time: 90 secondsSubstrate: Perkin Elmer
Protocols
Datasheets and documents
-
Datasheet download
References (19)
ab167609 has been referenced in 19 publications.
- Dang L et al. Downregulation of sperm-associated antigen 5 inhibits melanoma progression by regulating forkhead box protein M1/A disintegrin and metalloproteinase 17/NOTCH1 signaling. Bioengineered 13:4744-4756 (2022). PubMed: 35138218
- Kang GJ et al. PRR16/Largen Induces Epithelial-Mesenchymal Transition through the Interaction with ABI2 Leading to the Activation of ABL1 Kinase. Biomol Ther (Seoul) 30:340-347 (2022). PubMed: 35719027
- Cai S et al. Reduced kinase D‑interacting substrate of 220 kDa (Kidins220) in pancreatic cancer promotes EGFR/ERK signalling and disease progression. Int J Oncol 58:N/A (2021). PubMed: 33955519
- He X et al. Oestrogen induces epithelial-mesenchymal transition in endometriosis via circ_0004712/miR-148a-3p sponge function. J Cell Mol Med 24:9658-9666 (2020). PubMed: 32667746
- Xiong W et al. E2 -mediated EMT by activation of ß-catenin/Snail signalling during the development of ovarian endometriosis. J Cell Mol Med 23:8035-8045 (2019). PubMed: 31560827