Overview

  • Product nameAnti-SNAPC3 antibody
    See all SNAPC3 primary antibodies
  • Description
    Rabbit polyclonal to SNAPC3
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 216-265 (

    RDSIRCVSDLQIGGEFSNTPDQAPEHISKDLYKSAFFYFEGTFYNDKRYP

    ) of Human SNAPC3 (NP_001034786).

  • Positive control
    • PANC1 nuclear lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab94560 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 47 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionPart of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. Binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • MGC132011 antibody
    • MGC33124 antibody
    • Proximal sequence element-binding transcription factor subunit beta antibody
    • PSE binding factor subunit beta antibody
    • PSE-binding factor subunit beta antibody
    • PTF subunit beta antibody
    • PTFbeta antibody
    • small nuclear RNA activating complex, polypeptide 3, 50kDa antibody
    • Small nuclear RNA-activating complex polypeptide 3 antibody
    • SNAP50 antibody
    • SNAPc 50 kDa subunit antibody
    • SNAPc subunit 3 antibody
    • SNAPC3 antibody
    • SNPC3_HUMAN antibody
    • snRNA activating protein complex 50 kDa subunit antibody
    • snRNA activating protein complex subunit 3 antibody
    • snRNA-activating protein complex 50 kDa subunit antibody
    • snRNA-activating protein complex subunit 3 antibody
    see all

Anti-SNAPC3 antibody images

References for Anti-SNAPC3 antibody (ab94560)

ab94560 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab94560.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"