Overview

  • Product name
  • Description
    Mouse polyclonal to SNAPIN
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Human SNAPIN aa 1-136. (AAH04494).
    Sequence:

    MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRES QVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQ NAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK


    Database link: O95295

  • Positive control
    • SNAPIN transfected 293T cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172446 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 15 kDa.

Target

  • Function
    May modulate a step between vesicle priming, fusion and calcium-dependent neurotransmitter release by potentiating the interaction of synaptotagmins with the SNAREs and the plasma-membrane-associated protein SNAP25. Its phosphorylation state influences exocytotic protein interactions and may regulate synaptic vesicle exocytosis. May also have a role in the mechanisms of SNARE-mediated membrane fusion in non-neuronal cells.
  • Tissue specificity
    Expressed in male germ cells of adult testis (at protein level).
  • Sequence similarities
    Belongs to the SNAPIN family.
  • Developmental stage
    Expressed in germ cells of 22-week prenatal testis.
  • Cellular localization
    Cytoplasm. Membrane. Cytoplasmic vesicle membrane. Cytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane. Cell junction > synapse > synaptosome. Cytoplasm > perinuclear region. May be cytoplasmic and peripheral membrane bound or anchored to the vesicular membrane through an N-terminal signal anchor (By similarity). Co-localizes with NANOS1 and PUM2 in the perinuclear region of germ cells.
  • Information by UniProt
  • Database links
  • Alternative names
    • OTTHUMP00000035157 antibody
    • SNAP associated protein antibody
    • SNAP-25-binding protein antibody
    • SNAP-associated protein antibody
    • SNAP25BP antibody
    • SNAPAP antibody
    • Snapin antibody
    • SNAPN_HUMAN antibody
    • SNARE associated protein snapin antibody
    • SNARE-associated protein Snapin antibody
    • Synaptosomal associated protein 25 binding protein antibody
    • Synaptosomal-associated protein 25-binding protein antibody
    see all

Images

  • All lanes : Anti-SNAPIN antibody (ab172446) at 1 µg/ml

    Lane 1 : SNAPIN transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 15 kDa

References

ab172446 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172446.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up