Overview

  • Product name
  • Description
    Mouse polyclonal to SOCS6
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Full length protein corresponding to Human SOCS6 aa 1-535. (NP_004223.2).
    Sequence:

    MKKISLKTLRKSFNLNKSKEETDFMVVQQPSLASDFGKDDSLFGSCYGKD MASCDINGEDEKGGKNRSKSESLMGTLKRRLSAKQKSKGKAGTPSGSSAD EDTFSSSSAPIVFKDVRAQRPIRSTSLRSHHYSPAPWPLRPTNSEETCIK MEVRVKALVHSSSPSPALNGVRKDFHDLQSETTCQEQANSLKSSASHNGD LHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSYCLDSSSPMEV SAVPPQVGGRAFPEDESQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSP RAGHDDVPPLSPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNS APGVARVYDSVQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLAN VPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEG HTSIVDLIEHSIRDSENGAFCYSRSRLPGSATYPVRLTNPVSRFMQVRSL QYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY


    Database link: O14544

  • Positive control
    • SOCS6 transfected 293T cell line lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172344 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 60 kDa.

Target

  • Function
    SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. May be a substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 SH2 domain.
    Contains 1 SOCS box domain.
  • Domain
    The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin ligase complexes.
  • Information by UniProt
  • Database links
  • Alternative names
    • CIS-4 antibody
    • CIS4 antibody
    • Cish4 antibody
    • Cytokine inducible SH2 protein 4 antibody
    • Cytokine-inducible SH2 protein 4 antibody
    • HSPC060 antibody
    • SOCS-4 antibody
    • SOCS-6 antibody
    • SOCS4 antibody
    • Socs6 antibody
    • SOCS6_HUMAN antibody
    • SSI4 antibody
    • STAI4 antibody
    • STAT induced STAT inhibitor 4 antibody
    • STAT4 antibody
    • STATI4 antibody
    • Suppressor of cytokine signaling 4 antibody
    • Suppressor of cytokine signaling 6 antibody
    see all

Images

  • All lanes : Anti-SOCS6 antibody (ab172344) at 1 µg/ml

    Lane 1 : SOCS6 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 60 kDa

References

ab172344 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172344.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up