Anti-Solute carrier family 22 member 18 antibody (ab168960)

Overview

  • Product name
    Anti-Solute carrier family 22 member 18 antibody
    See all Solute carrier family 22 member 18 primary antibodies
  • Description
    Mouse polyclonal to Solute carrier family 22 member 18
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human Solute carrier family 22 member 18 aa 1-424.
    Sequence:

    MQGARAPRDQGQSPGRMSALGRSSVILLTYVLAATELTCLFMQFSIVPYL SRKLGLDSIAFGYLQTTFGVLQLLGGPVFGRFADQRGARAALTLSFLAAL ALYLLLAAASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERP AALGRLGLCFGVGVILGSLLGGTLVSAYGIQCPAILAALATLLGAVLSFT CIPASTKGAKTDAQAPLPGGPRASVFDLKAIASLLRLPDVPRIFLVKVAS NCPTGLFMVMFSIISMDFFQLEAAQAGYLMSFFGLLQMVTQGLVIGQLSS HFSEEVLLRASVLVFIVVGLAMAWMSSVFHFCLLVPGLVFSLCTLNVVTD SMLIKAVSTSDTGTMLGLCASVQPLLRTLGPTVGGLLYRSFGVPVFGHVQ VAINTLVLLVLWRKPMPQRKDKVR


    Database link: NP_002546.2

  • Positive control
    • Solute carrier family 22 member 18 transfected 293T cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab168960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa.

Target

  • Relevance
    Solute carrier family 22 member 18 may act as a transporter of organic cations based on a proton efflux antiport mechanism. It may also play a role in the transport of chloroquine and quinidine-related compounds in kidney.
  • Cellular localization
    Apical cell membrane; Multi-pass membrane protein (Potential). Note: Localized at the apical membrane surface of renal proximal tubules.
  • Database links
  • Alternative names
    • Beckwith Wiedemann syndrome chromosomal region 1 candidate gene A protein antibody
    • Beckwith Wiedemann syndrome chromosome region 1 candidate A antibody
    • BWR1A antibody
    • BWSCR1A antibody
    • DKFZp667A184 antibody
    • Efflux transporter like protein antibody
    • HET antibody
    • Imprinted multi membrane spanning polyspecific transporter related protein 1 antibody
    • IMPT1 antibody
    • ITM antibody
    • MGC94186 antibody
    • ORCTL 2 antibody
    • ORCTL2 antibody
    • Organic cation transporter like protein 2 antibody
    • OTTMUSP00000030799 antibody
    • OTTMUSP00000030800 antibody
    • p45 Beckwith Wiedemann region 1 A antibody
    • p45 BWR1A antibody
    • SLC22A18 antibody
    • SLC22A1L antibody
    • Solute carrier family 22 member 1 like antibody
    • TSSC5 antibody
    • TSSC5v antibody
    • Tumor suppressing STF cDNA 5 protein antibody
    • Tumor suppressing subchromosomal transferable fragment candidate gene 5 protein antibody
    see all

Images

  • All lanes : Anti-Solute carrier family 22 member 18 antibody (ab168960) at 1 µg/ml

    Lane 1 : Solute carrier family 22 member 18 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 45 kDa

References

ab168960 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168960.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up