Anti-Solute carrier family 22 member 18 antibody (ab83674)

Overview

  • Product name
    Anti-Solute carrier family 22 member 18 antibody
    See all Solute carrier family 22 member 18 primary antibodies
  • Description
    Rabbit polyclonal to Solute carrier family 22 member 18
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Horse, Guinea pig, Cow
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 108-157 (AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRL G) of Human Solute carrier family 22 member 18 (NP_002546)

  • Positive control
    • HepG2 cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab83674 is purified by a peptide affinity chromatography method.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab83674 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 45 kDa (predicted molecular weight: 45 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/312500.

Target

  • Relevance
    Solute carrier family 22 member 18 may act as a transporter of organic cations based on a proton efflux antiport mechanism. It may also play a role in the transport of chloroquine and quinidine-related compounds in kidney.
  • Cellular localization
    Apical cell membrane; Multi-pass membrane protein (Potential). Note: Localized at the apical membrane surface of renal proximal tubules.
  • Database links
  • Alternative names
    • Beckwith Wiedemann syndrome chromosomal region 1 candidate gene A protein antibody
    • Beckwith Wiedemann syndrome chromosome region 1 candidate A antibody
    • BWR1A antibody
    • BWSCR1A antibody
    • DKFZp667A184 antibody
    • Efflux transporter like protein antibody
    • HET antibody
    • Imprinted multi membrane spanning polyspecific transporter related protein 1 antibody
    • IMPT1 antibody
    • ITM antibody
    • MGC94186 antibody
    • ORCTL 2 antibody
    • ORCTL2 antibody
    • Organic cation transporter like protein 2 antibody
    • OTTMUSP00000030799 antibody
    • OTTMUSP00000030800 antibody
    • p45 Beckwith Wiedemann region 1 A antibody
    • p45 BWR1A antibody
    • SLC22A18 antibody
    • SLC22A1L antibody
    • Solute carrier family 22 member 1 like antibody
    • TSSC5 antibody
    • TSSC5v antibody
    • Tumor suppressing STF cDNA 5 protein antibody
    • Tumor suppressing subchromosomal transferable fragment candidate gene 5 protein antibody
    see all

Anti-Solute carrier family 22 member 18 antibody images

  • Anti-Solute carrier family 22 member 18 antibody (ab83674) at 1 µg/ml + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 45 kDa
    Observed band size : 45 kDa

References for Anti-Solute carrier family 22 member 18 antibody (ab83674)

ab83674 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83674.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up