Overview

  • Product nameAnti-Somatostatin antibody
    See all Somatostatin primary antibodies
  • Description
    Rabbit polyclonal to Somatostatin
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Sheep, Rabbit, Goat, Horse, Guinea pig, Cow, Cat, Dog, Human
  • Immunogen

    Synthetic peptide corresponding to Mouse Somatostatin aa 35-84.
    Sequence:

    LQKSLAAATGKQELAKYFLAELLSEPNQTENDALEPEDLPQAAEQDEMRL


    Database link: P60041

  • Positive control
    • Rat liver lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab123245 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 13 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-Somatostatin antibody images

  • Anti-Somatostatin antibody (ab123245) at 1 µg/ml + Rat liver lysate at 10 µg

    Secondary
    Goat anti-Rabbit IgG HRP

    Predicted band size : 13 kDa

References for Anti-Somatostatin antibody (ab123245)

ab123245 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123245.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"