Anti-Somatostatin Receptor 3 antibody (ab125404)

Overview

  • Product nameAnti-Somatostatin Receptor 3 antibody
    See all Somatostatin Receptor 3 primary antibodies
  • Description
    Rabbit polyclonal to Somatostatin Receptor 3
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Saccharomyces cerevisiae
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 337-386 (SQEPTVGPPEKTEEEDEEEEDGEESREGGKGKEMNGRVSQITQPGTSGQ E) of Human Somatostatin Receptor 3 (NP_001042; P32745).

  • Positive control
    • Fetal Kidney Lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab125404 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 46 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionReceptor for somatostatins-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase.
  • Tissue specificityBrain, pituitary and pancreas.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications
    Phosphorylated. Phosphorylation increases upon somatostatin binding.
  • Cellular localizationCell membrane. Internalized into endoplasmic vesicles upon somatostatin-stimulation.
  • Information by UniProt
  • Database links
  • Alternative names
    • OTTHUMP00000028737 antibody
    • Smstr 3 antibody
    • Smstr3 antibody
    • Somatostatin receptor subtype 3 antibody
    • Somatostatin receptor type 3 antibody
    • SS 3R antibody
    • SS-3-R antibody
    • SS3-R antibody
    • SS3R antibody
    • SSR 28 antibody
    • SSR-28 antibody
    • SSR28 antibody
    • SSR3_HUMAN antibody
    • Sst 3 antibody
    • Sst3 antibody
    • SSTR 3 antibody
    • SSTR3 antibody
    see all

Anti-Somatostatin Receptor 3 antibody images

  • Anti-Somatostatin Receptor 3 antibody (ab125404) at 1 µg/ml + Fetal Kidney Lysate

    Predicted band size : 46 kDa

References for Anti-Somatostatin Receptor 3 antibody (ab125404)

ab125404 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab125404.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"