Anti-Sorbitol Dehydrogenase antibody [AT10F4] (ab180261)

Overview

  • Product name
    Anti-Sorbitol Dehydrogenase antibody [AT10F4]
    See all Sorbitol Dehydrogenase primary antibodies
  • Description
    Mouse monoclonal [AT10F4] to Sorbitol Dehydrogenase
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Sheep, Cow, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human Sorbitol Dehydrogenase aa 1-357. Purified from E. coli.
    Sequence:

    MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVH YWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPR ENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFE EGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQV VVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIEC TGAEASIQAGIYATRSGGNLVLVGLGSEMTTVPLLHAAIREVDIKGVFRY CNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKC DPSDQNP


    Database link: Q00796

  • Positive control
    • Jurkat cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab180261 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 38 kDa.

Target

  • Function
    Converts sorbitol to fructose. Part of the polyol pathway that plays an important role in sperm physiology. May play a role in the sperm motility by providing an energetic source for sperm.
  • Tissue specificity
    Expressed in kidney and epithelial cells of both benign and malignant prostate tissue. Expressed in epididymis (at protein level).
  • Sequence similarities
    Belongs to the zinc-containing alcohol dehydrogenase family.
  • Cellular localization
    Mitochondrion membrane. Cell projection > cilium > flagellum. Associated with mitochondria of the midpiece and near the plasma membrane in the principal piece of the flagellum. Also found in the epididymosome, secreted by the epididymal epithelium and that transfers proteins from the epididymal fluid to the sperm surface.
  • Information by UniProt
  • Database links
  • Alternative names
    • DHSO_HUMAN antibody
    • L iditol 2 dehydrogenase antibody
    • L-iditol 2-dehydrogenase antibody
    • OTTHUMP00000161939 antibody
    • SDH antibody
    • Sorbitol dehydrogenase 1 antibody
    • Sorbitol dehydrogenase antibody
    • SORD 1 antibody
    • SORD antibody
    • SORD1 antibody
    see all

Images

  • Anti-Sorbitol Dehydrogenase antibody [AT10F4] (ab180261) at 1/1000 dilution + Jurkat cell lysate at 40 µg

    Secondary
    goat anti-mouse secondary antibody conjugated to HRP
    Developed using the ECL technique

    Predicted band size : 38 kDa

References

ab180261 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180261.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up