Overview

  • Product nameAnti-SOX10 antibody
    See all SOX10 primary antibodies
  • Description
    Rabbit polyclonal to SOX10
  • Tested applicationsSuitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to SOX10.
    Sequence:

    PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT

Properties

Applications

Our Abpromise guarantee covers the use of ab108408 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 50 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • FunctionTranscription factor that seems to function synergistically with the POU domain protein TST-1/OCT6/SCIP. Could confer cell specificity to the function of other transcription factors in developing and mature glia.
  • Tissue specificityExpressed in fetal brain and in adult brain, heart, small intestine and colon.
  • Involvement in diseaseDefects in SOX10 are the cause of Waardenburg syndrome type 2E (WS2E) [MIM:611584]. WS2 is a genetically heterogeneous, autosomal dominant disorder characterized by sensorineural deafness, pigmentary disturbances, and absence of dystopia canthorum. The frequency of deafness is higher in WS2 than in WS1.
    Defects in SOX10 are a cause of Waardenburg syndrome type 4C (WS4C) [MIM:613266]; also known as Waardenburg-Shah syndrome. WS4C is characterized by the association of Waardenburg features (depigmentation and deafness) and the absence of enteric ganglia in the distal part of the intestine (Hirschsprung disease).
    Defects in SOX10 are a cause of Yemenite deaf-blind hypopigmentation syndrome (YDBHS) [MIM:601706]. YDBHS consists of cutaneous hypopigmented and hyperpigmented spots and patches, microcornea, coloboma and severe hearing loss. Another case observed in a girl with similar skin symptoms and hearing loss but without microcornea or coloboma is reported as a mild form of this syndrome.
    Defects in SOX10 are the cause of peripheral demyelinating neuropathy, central dysmyelinating leukodystrophy, Waardenburg syndrome, and Hirschsprung disease (PCWH) [MIM:609136]; also called neurologic variant of Waardenburg-Shah syndrome. PCWH is a rare, complex and more severe neurocristopathy that includes features of 4 distinct syndromes: peripheral demyelinating neuropathy, central dysmyelinating leukodystrophy, Waardenburg syndrome, and Hirschsprung disease.
  • Sequence similaritiesContains 1 HMG box DNA-binding domain.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • DOM antibody
    • DOM antibody
    • Dominant megacolon mouse human homolog of antibody
    • MGC15649 antibody
    • PCWH antibody
    • SOX 10 antibody
    • SOX10 antibody
    • SOX10_HUMAN antibody
    • SRY (sex determining region Y) box 10 antibody
    • SRY (sex determining region Y) box 10 antibody
    • SRY box 10 antibody
    • SRY box containing gene 10 antibody
    • SRY related HMG box gene 10 antibody
    • SRY related HMG box gene 10 antibody
    • Transcription factor SOX 10 antibody
    • Transcription factor SOX-10 antibody
    • WS2E antibody
    • WS4 antibody
    • WS4C antibody
    see all

Anti-SOX10 antibody images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human skin tissue, staining SOX10 with ab108408 at 4 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human kidney tissue, staining SOX10 with ab108408 at 4 µg/ml.

  • Anti-SOX10 antibody (ab108408) at 1/4000 dilution

    Secondary
    1/10000

    Predicted band size : 50 kDa
    Sample: HEK293 whole cell lysate


  • Predicted band size : 50 kDa

References for Anti-SOX10 antibody (ab108408)

This product has been referenced in:
  • Gambichler T  et al. Prognostic relevance of high atonal homolog-1 expression in Merkel cell carcinoma. J Cancer Res Clin Oncol N/A:N/A (2016). Read more (PubMed: 27624714) »

See 1 Publication for this product

Product Wall

Thank you for your enquiry,

We have the following general IHC-P procedure from the originator of this antibody. As stated on the online datasheet, the recommended starting dilution for the antibody is 4 - 8 µg/ml.

Please note t...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"