Overview

  • Product name
  • Description
    Rabbit polyclonal to SOX17
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human, Chimpanzee, Fish, Monkey, Zebrafish, Opossum
  • Immunogen

    Synthetic peptide corresponding to Human SOX17 aa 70-120.
    Sequence:

    RPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVE E


    Database link: Q9H6I2

  • Positive control
    • Human uterus tissue, Human testis tissue, Mouse embryo brain lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab155402 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 3 µg/ml. Predicted molecular weight: 44 kDa.
IHC-P Use a concentration of 5 - 10 µg/ml.

Target

  • Function
    Acts as transcription regulator that binds target promoter DNA and bends the DNA. Binds to the sequences 5'-AACAAT-'3 or 5'-AACAAAG-3'. Modulates transcriptional regulation via WNT3A. Inhibits Wnt signaling. Promotes degradation of activated CTNNB1. Plays a key role in the regulation of embryonic development. Required for normal looping of the embryonic heart tube. Required for normal development of the definitive gut endoderm. Probable transcriptional activator in the premeiotic germ cells.
  • Tissue specificity
    Expressed in adult heart, lung, spleen, testis, ovary, placenta, fetal lung, and kidney. In normal gastrointestinal tract, it is preferentially expressed in esophagus, stomach and small intestine than in colon and rectum.
  • Involvement in disease
    Defects in SOX17 are the cause of vesicoureteral reflux type 3 (VUR3) [MIM:613674]. VUR3 is a disease belonging to the group of congenital anomalies of the kidney and urinary tract. It is characterized by the reflux of urine from the bladder into the ureters and sometimes into the kidneys, and is a risk factor for urinary tract infections. Primary disease results from a developmental defect of the ureterovesical junction. In combination with intrarenal reflux, the resulting inflammatory reaction may result in renal injury or scarring, also called reflux nephropathy. Extensive renal scarring impairs renal function and may predispose patients to hypertension, proteinuria, renal insufficiency and end-stage renal disease.
  • Sequence similarities
    Contains 1 HMG box DNA-binding domain.
    Contains 1 Sox C-terminal domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ22252 antibody
    • SOX17 antibody
    • SOX17_HUMAN antibody
    • SRY (sex determining region Y) box 17 antibody
    • SRY box 17 antibody
    • SRY related HMG box transcription factor SOX17 antibody
    • Transcription factor SOX-17 antibody
    • Transcription factor SOX17 antibody
    • VUR3 antibody
    see all

Images

  • All lanes : Anti-SOX17 antibody (ab155402) at 1 µg/ml

    Lane 1 : Mouse embryo brain lysate
    Lane 2 : Mouse embryo brain lysate with immunizing peptide

    Secondary
    All lanes : Goat anti-rabbit Ig HRP

    Developed using the ECL technique.

    Predicted band size: 44 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human uterus tissue labeling SOX17 using ab155402 at 10 µg/ml.
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human testis tissue labeling SOX17 using ab155402 at 10 µg/ml.

References

This product has been referenced in:
  • Jiang X  et al. Let-7 microRNA-dependent control of leukotriene signaling regulates the transition of hematopoietic niche in mice. Nat Commun 8:128 (2017). Read more (PubMed: 28743859) »
  • Bonney S  et al. Diverse Functions of Retinoic Acid in Brain Vascular Development. J Neurosci 36:7786-801 (2016). Read more (PubMed: 27445154) »

See all 2 Publications for this product

Customer reviews and Q&As

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (Testis, postnatal day 6)
Permeabilization
Yes - 0.1% Triton X-100 in PBS
Specification
Testis, postnatal day 6
Blocking step
BSA as blocking agent for 30 minute(s) · Concentration: 3% · Temperature: 20°C
Fixative
Paraformaldehyde
Username

Mr. Bryan Niedenberger

Verified customer

Submitted Aug 22 2017

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up