Anti-SOX17 antibody (ab33101)

Overview

  • Product nameAnti-SOX17 antibody
    See all SOX17 primary antibodies
  • Description
    Rabbit polyclonal to SOX17
  • Tested applicationsSuitable for: ELISA, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Guinea pig, Cow, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human SOX17 aa 345-394 (C terminal).
    Sequence:

    GTDPSQPAELLGEVDRTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGA


    Database link: Q9H6I2

  • Positive control
    • fetal lung lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab33101 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/312500.
WB Use a concentration of 0.5 µg/ml. Predicted molecular weight: 44 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionActs as transcription regulator that binds target promoter DNA and bends the DNA. Binds to the sequences 5'-AACAAT-'3 or 5'-AACAAAG-3'. Modulates transcriptional regulation via WNT3A. Inhibits Wnt signaling. Promotes degradation of activated CTNNB1. Plays a key role in the regulation of embryonic development. Required for normal looping of the embryonic heart tube. Required for normal development of the definitive gut endoderm. Probable transcriptional activator in the premeiotic germ cells.
  • Tissue specificityExpressed in adult heart, lung, spleen, testis, ovary, placenta, fetal lung, and kidney. In normal gastrointestinal tract, it is preferentially expressed in esophagus, stomach and small intestine than in colon and rectum.
  • Involvement in diseaseDefects in SOX17 are the cause of vesicoureteral reflux type 3 (VUR3) [MIM:613674]. VUR3 is a disease belonging to the group of congenital anomalies of the kidney and urinary tract. It is characterized by the reflux of urine from the bladder into the ureters and sometimes into the kidneys, and is a risk factor for urinary tract infections. Primary disease results from a developmental defect of the ureterovesical junction. In combination with intrarenal reflux, the resulting inflammatory reaction may result in renal injury or scarring, also called reflux nephropathy. Extensive renal scarring impairs renal function and may predispose patients to hypertension, proteinuria, renal insufficiency and end-stage renal disease.
  • Sequence similaritiesContains 1 HMG box DNA-binding domain.
    Contains 1 Sox C-terminal domain.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ22252 antibody
    • SOX17 antibody
    • SOX17_HUMAN antibody
    • SRY (sex determining region Y) box 17 antibody
    • SRY box 17 antibody
    • SRY related HMG box transcription factor SOX17 antibody
    • Transcription factor SOX-17 antibody
    • Transcription factor SOX17 antibody
    • VUR3 antibody
    see all

Anti-SOX17 antibody images

  • Anti-SOX17 antibody (ab33101) at 1 µg/ml + DU 145 (Human prostate carcinoma cell line) Whole Cell Lysate at 10 µg

    Secondary
    Goat polyclonal to Rabbit IgG - H&L - Pre-Adsorbed (HRP) at 1/3000 dilution

    Predicted band size : 44 kDa
    Observed band size : 44 kDa

References for Anti-SOX17 antibody (ab33101)

ab33101 has not yet been referenced specifically in any publications.

Product Wall

Abcam has not validated the combination of species/application used in this Abreview.
Application Immunocytochemistry/ Immunofluorescence
Sample Human Cell (2 day differentiated embryonic stem cells)
Specification 2 day differentiated embryonic stem cells
Fixative Paraformaldehyde
Permeabilization Yes - Triton X100
Blocking step Donkey serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C
Username

Abcam user community

Verified customer

Submitted Aug 09 2010

Thank you for your enquiry. To our knowledge, ab33101 (SOX17 antibody) has not been tested in IHC therefore, we can not guarantee that it will work in this application. All tested applications are specified on Abcam product datasheets. If you de...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"