Overview

  • Product name
  • Description
    Rabbit polyclonal to Sp8
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide within Human Sp8 aa 375-424. The exact sequence is proprietary.
    Sequence:

    AHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKR


    Database link: Q8IXZ3

  • Positive control
    • 721_B whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab178962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 48 kDa.

Target

Images

  • Anti-Sp8 antibody (ab178962) at 1 µg/ml + 721_B whole cell lysate at 10 µg

    Predicted band size: 48 kDa

References

ab178962 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Abcam has not validated the combination of species/application used in this Abreview.
Application
IHC - Wholemount
Sample
Drosophila melanogaster Embryo (0 - 17 hour embryos)
Specification
0 - 17 hour embryos
Username

Heather Bruce

Verified customer

Submitted May 26 2017

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up