Overview

  • Product name
  • Description
    Rabbit polyclonal to SPACA4
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 39-88 (

    MHCGDDEDCFTGHGVAPGTGPVINKGCLRATSCGLEEPVSYRGVTYSLTT

    ) of Human SPACA4 (NP_598005)

  • Positive control
    • Jurkat cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Constituents: 98% PBS, 2% Sucrose
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab125313 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 13 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization.
  • Tissue specificity
    Testis specific. Expressed in spermatozoa.
  • Sequence similarities
    Contains 1 UPAR/Ly6 domain.
  • Cellular localization
    Cell membrane. Cytoplasmic vesicle > secretory vesicle > acrosome. Expressed in acrosomal matrix and outer and inner acrosomal membranes.
  • Information by UniProt
  • Database links
  • Alternative names
    • SACA4_HUMAN antibody
    • SAMP14 antibody
    • SPACA4 antibody
    • sperm acrosomal membrane protein 14 antibody
    • Sperm acrosomal membrane-associated protein 14 antibody
    • Sperm acrosome membrane-associated protein 4 antibody
    see all

Anti-SPACA4 antibody images

  • Anti-SPACA4 antibody (ab125313) at 1 µg/ml + Jurkat cell lysate at 10 µg

    Predicted band size : 13 kDa

References for Anti-SPACA4 antibody (ab125313)

ab125313 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab125313.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up