Overview

  • Product nameAnti-SPACA4 antibody
    See all SPACA4 primary antibodies
  • Description
    Rabbit polyclonal to SPACA4
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 39-88 (

    MHCGDDEDCFTGHGVAPGTGPVINKGCLRATSCGLEEPVSYRGVTYSLTT

    ) of Human SPACA4 (NP_598005)

  • Positive control
    • Jurkat cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 98% PBS, 2% Sucrose
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab125313 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 13 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionSperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization.
  • Tissue specificityTestis specific. Expressed in spermatozoa.
  • Sequence similaritiesContains 1 UPAR/Ly6 domain.
  • Cellular localizationCell membrane. Cytoplasmic vesicle > secretory vesicle > acrosome. Expressed in acrosomal matrix and outer and inner acrosomal membranes.
  • Information by UniProt
  • Database links
  • Alternative names
    • SACA4_HUMAN antibody
    • SAMP14 antibody
    • SPACA4 antibody
    • sperm acrosomal membrane protein 14 antibody
    • Sperm acrosomal membrane-associated protein 14 antibody
    • Sperm acrosome membrane-associated protein 4 antibody
    see all

Anti-SPACA4 antibody images

  • Anti-SPACA4 antibody (ab125313) at 1 µg/ml + Jurkat cell lysate at 10 µg

    Predicted band size : 13 kDa

References for Anti-SPACA4 antibody (ab125313)

ab125313 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab125313.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"