Anti-SPATA20 antibody - C-terminal (ab182089)

Overview

  • Product name
    Anti-SPATA20 antibody - C-terminal
    See all SPATA20 primary antibodies
  • Description
    Rabbit polyclonal to SPATA20 - C-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human SPATA20 aa 378-427 (C terminal). The exact sequence is proprietary.
    Sequence:

    GFYSAEDADSPPERGQRPKEGAYYVWTVKEVQQLLPEPVLGATEPLTSGQ


    Database link: Q8TB22-4

  • Positive control
    • Human colorectal tumor lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab182089 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 58 kDa.

Target

Images

  • Anti-SPATA20 antibody - C-terminal (ab182089) at 1 µg/ml + Human colorectal tumor lysate at 10 µg

    Predicted band size : 58 kDa

References

ab182089 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182089.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up