Anti-sphingosine-1-phosphate phosphatase 1 antibody (ab108435)

Overview

  • Product name
    Anti-sphingosine-1-phosphate phosphatase 1 antibody
    See all sphingosine-1-phosphate phosphatase 1 primary antibodies
  • Description
    Rabbit polyclonal to sphingosine-1-phosphate phosphatase 1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human sphingosine-1-phosphate phosphatase 1 aa 287-336 (internal sequence).
    Sequence:

    THKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVT


    Database link: NP_110418
    (Peptide available as ab223885)

  • Positive control
    • Jurkat cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab108435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 49 kDa.Can be blocked with Human sphingosine-1-phosphate phosphatase 1 peptide (ab223885). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance
    Sphingosine-1-phosphate phosphatase 1 (Spp1) regulates intracellular and extracellular sphingosine 1 phosphate(S1P)levels. It belongs to the type 2 lipid phosphate phosphatase family and is expressed in the endoplasmic reticulum (ER) membrane.
  • Database links
  • Alternative names
    • hSPPase1 antibody
    • SGPP1 antibody
    • Sphingosine-1-phosphatase 1 antibody
    • Spp1 antibody
    • SPPase1 antibody
    see all

Images



  • Predicted band size : 49 kDa
    Western blot analysis of OVCAR-3 lysate labeling sphingosine-1-phosphate with ab108435 at 1.0µg/ml.


  • Predicted band size : 49 kDa
    Western blot analysis of HeLa cell lysate labeling sphingosine-1-phosphate with ab108435 at 1.0µg/ml.
  • Anti-sphingosine-1-phosphate phosphatase 1 antibody (ab108435) at 1 µg/ml + Jurkat cell lysate at 10 µg

    Predicted band size : 49 kDa
    Gel concentration 12%

References

ab108435 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab108435.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up