Anti-sphingosine-1-phosphate phosphatase 1 antibody (ab108435)

Overview

  • Product name
    Anti-sphingosine-1-phosphate phosphatase 1 antibody
    See all sphingosine-1-phosphate phosphatase 1 primary antibodies
  • Description
    Rabbit polyclonal to sphingosine-1-phosphate phosphatase 1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human sphingosine-1-phosphate phosphatase 1 aa 287-336 (internal sequence).
    Sequence:

    THKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVT


    Database link: NP_110418
    (Peptide available as ab223885)

  • Positive control
    • Jurkat cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab108435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 49 kDa.Can be blocked with Human sphingosine-1-phosphate phosphatase 1 peptide (ab223885). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance
    Sphingosine-1-phosphate phosphatase 1 (Spp1) regulates intracellular and extracellular sphingosine 1 phosphate(S1P)levels. It belongs to the type 2 lipid phosphate phosphatase family and is expressed in the endoplasmic reticulum (ER) membrane.
  • Database links
  • Alternative names
    • hSPPase1 antibody
    • SGPP1 antibody
    • Sphingosine-1-phosphatase 1 antibody
    • Spp1 antibody
    • SPPase1 antibody
    see all

Anti-sphingosine-1-phosphate phosphatase 1 antibody images



  • Predicted band size : 49 kDa
    Western blot analysis of OVCAR-3 lysate labeling sphingosine-1-phosphate with ab108435 at 1.0µg/ml.


  • Predicted band size : 49 kDa
    Western blot analysis of HeLa cell lysate labeling sphingosine-1-phosphate with ab108435 at 1.0µg/ml.
  • Anti-sphingosine-1-phosphate phosphatase 1 antibody (ab108435) at 1 µg/ml + Jurkat cell lysate at 10 µg

    Predicted band size : 49 kDa
    Gel concentration 12%

References for Anti-sphingosine-1-phosphate phosphatase 1 antibody (ab108435)

ab108435 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108435.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up