Overview

  • Product name
  • Description
    Mouse polyclonal to SPHK1
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human SPHK1 aa 1-398.
    Sequence:

    MDPVVGCGRGLFGFVFSAGGPRGVLPRPCRVLVLLNPRGGKGKALQLFRS HVQPLLAEAEISFTLMLTERRNHARELVRSEELGRWDALVVMSGDGLMHE VVNGLMERPDWETAIQKPLCSLPAGSGNALAASLNHYAGYEQVTNEDLLT NCTLLLCRRLLSPMNLLSLHTASGLRLFSVLSLAWGFIADVDLESEKYRR LGEMRFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVDA HLVPLEEPVPSHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRCAAGVMH LFYVRAGVSRAMLLRLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGKG VFAVDGELMVSEAVQGQVHPNYFWMVSGCVEPPPSWKPQQMPPPEEPL


    Database link: NP_068807.2

  • Positive control
    • SPHK1 transfected 293T cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172290 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa.

Target

  • Function
    Catalyzes the phosphorylation of sphingosine to form sphingosine 1-phosphate (SPP), a lipid mediator with both intra-and extracellular functions. Also acts on D-erythro-sphingosine and to a lesser extent sphinganine, but not other lipids, such as D,L-threo-dihydrosphingosine, N,N-dimethylsphingosine, diacylglycerol, ceramide, or phosphatidylinositol.
  • Tissue specificity
    Widely expressed with highest levels in adult liver, kidney, heart and skeletal muscle.
  • Sequence similarities
    Contains 1 DAGKc domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • SK 1 antibody
    • SK1 antibody
    • Sphingosine kinase 1 antibody
    • SPHK 1 antibody
    • SPHK antibody
    • Sphk1 antibody
    • SPHK1_HUMAN antibody
    • SPK antibody
    • SPK 1 antibody
    see all

Images

  • All lanes : Anti-SPHK1 antibody (ab172290) at 1 µg/ml

    Lane 1 : SPHK1 transfected 293T cell lysate
    Lane 2 : Non-transfected cell lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 43 kDa

References

ab172290 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172290.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up