Overview

  • Product name
  • Description
    Rabbit polyclonal to SPIRE2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human SPIRE2 aa 371-448.
    Sequence:

    SLPCILNACSGDAKSTSCINLSVTDAGGSAQRPRPRVLLKAPTLAEMEEM NTSEEEESPCGEVTLKRDRSFSEHDLAQ


    Database link: Q8WWL2

  • Positive control
    • Human stomach tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab184831 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Acts as a actin nucleation factor, remains associated with the slow-growing pointed end of the new filament. Involved in vesicle transport processes providing a novel link between actin organization and intracellular transport.
  • Sequence similarities
    Belongs to the spire family.
    Contains 1 KIND domain.
    Contains 3 WH2 domains.
  • Domain
    Binds to actin monomers via the WH2 domain.
    The Spir-box targets binding to intracellular membrane structures.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links
  • Alternative names
    • MGC117166 antibody
    • Protein spire homolog 2 antibody
    • Spir-2 antibody
    • SPIR2_HUMAN antibody
    • Spire homolog 2 (Drosophila) antibody
    • SPIRE2 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin embedded Human stomach tissue labeling SPIRE2 with ab184831 at 1/2500.

References

ab184831 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab184831.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up