Overview

  • Product name
  • Description
    Rabbit polyclonal to SPO11
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human SPO11 aa 108-157 (N terminal).
    Sequence:

    AQKFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDI


    Database link: NP_036576

Properties

Applications

Our Abpromise guarantee covers the use of ab81695 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 44 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent dilution.

Target

  • Function
    Required for meiotic recombination. Mediates DNA cleavage that forms the double-strand breaks (DSB) that initiate meiotic recombination (By similarity). Essential for the phosphorylation of SMC3, HORMAD1 and HORMAD2.
  • Tissue specificity
    Highly expressed in testis.
  • Sequence similarities
    Belongs to the TOP6A family.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cancer/testis antigen 35 antibody
    • CT35 antibody
    • Meiotic recombination protein SPO 11 antibody
    • Meiotic recombination protein SPO11 antibody
    • MGC39953 antibody
    • SPATA43 antibody
    • Spermatogenesis associated 43 antibody
    • SPO 11 antibody
    • SPO11 antibody
    • SPO11 meiotic protein covalently bound to DSB antibody
    • SPO11 meiotic protein covalently bound to DSB homolog antibody
    • SPO11 meiotic protein covalently bound to DSB like antibody
    • SPO11_HUMAN antibody
    • TOPVIA antibody
    see all

Images

  • Anti-SPO11 antibody (ab81695) (0.2-1 ug/ml) + HepG2 cell lysate

    Predicted band size : 44 kDa
  • Anti-SPO11 antibody (ab81695) at 1 µg/ml + human 293T

    Predicted band size : 44 kDa

References

This product has been referenced in:
  • Litvinov IV  et al. Ectopic expression of cancer-testis antigens in cutaneous T-cell lymphoma patients. Clin Cancer Res 20:3799-808 (2014). Human . Read more (PubMed: 24850846) »
  • Lindsey SF  et al. Potential role of meiosis proteins in melanoma chromosomal instability. J Skin Cancer 2013:190109 (2013). WB . Read more (PubMed: 23840955) »

See all 2 Publications for this product

Customer reviews and Q&As

Abreviews
Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunocytochemistry/ Immunofluorescence
Blocking step
BSA as blocking agent for 30 minute(s) · Concentration: 1% · Temperature: 25°C
Sample
Mouse Cell (Testis spreads-meiotic cells)
Specification
Testis spreads-meiotic cells
Permeabilization
Yes - Triton X 0.05%
Fixative
Paraformaldehyde
Username

Abcam user community

Verified customer

Submitted May 28 2013

Thank you for contacting us.

The product ab24355 is the SPO11 peptide that was used as an immunogen for the polyclonal antibody ab22508. This antibody is one of our Fast Track products, and has only been tested in ELISA against the immunizing...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up