
  • Product name
  • Description
    Rabbit polyclonal to SRPR alpha
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 215-264 (EFIQKHGRGMEKSNKSTKSDAPKEKGKKAPRVWELGGCANKEVLDYSTP T) of Human SRPR alpha (NP_003130)

  • Positive control
    • HepG2 cell lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab86515 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 71 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Function
    Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system.
  • Sequence similarities
    Belongs to the GTP-binding SRP family.
  • Cellular localization
    Endoplasmic reticulum membrane. Thought to be anchored in the membrane through an interaction with SR-beta, which contains a bona fide transmembrane domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • Docking protein alpha antibody
    • DP alpha antibody
    • DP antibody
    • DP-alpha antibody
    • DPalpha antibody
    • MGC17355 antibody
    • MGC3650 antibody
    • MGC9571 antibody
    • signal recognition particle receptor (docking protein) antibody
    • Signal recognition particle receptor alpha subunit antibody
    • Signal recognition particle receptor antibody
    • Signal recognition particle receptor subunit alpha antibody
    • SR alpha antibody
    • SR-alpha antibody
    • SRalpha antibody
    • SRP alpha antibody
    • SRPalpha antibody
    • SRPR antibody
    • SRPR_HUMAN antibody
    see all


  • Anti-SRPR alpha antibody (ab86515) at 1 µg/ml + HepG2 cell lysate at 1 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 71 kDa


ab86515 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab86515.
Please use the links above to contact us or submit feedback about this product.


Sign up