Overview

  • Product name
    Anti-SSX2 antibody - N-terminal
    See all SSX2 primary antibodies
  • Description
    Rabbit polyclonal to SSX2 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Pig
  • Immunogen

    Synthetic peptide within Human SSX2 aa 21-70 (N terminal). The exact sequence is proprietary.
    Sequence:

    IQKAFDDIAKYFSKEEWEKMKASEKIFYVYMKRKYEAMTKLGFKATLPPF


    Database link: Q16385-2

  • Positive control
    • Human thyroid tumor lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab182361 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 25 kDa.Can be blocked with SSX2 peptide (ab192644).

Target

  • Function
    Could act as a modulator of transcription.
  • Tissue specificity
    Expressed at high level in the testis. Expressed at low level in thyroid. Not detected in tonsil, colon, lung, spleen, prostate, kidney, striated and smooth muscles. Detected in rhabdomyosarcoma and fibrosarcoma cell lines. Not detected in mesenchymal and epithelial cell lines.
  • Involvement in disease
    Note=A chromosomal aberration involving SSX2 may be a cause of synovial sarcoma. Translocation t(X;18)(p11.2;q11.2). The translocation is specifically found in more than 80% of synovial sarcoma. The fusion products SSXT-SSX1 or SSXT-SSX2 are probably responsible for transforming activity. Heterogeneity in the position of the breakpoint can occur (low frequency).
  • Sequence similarities
    Belongs to the SSX family.
    Contains 1 KRAB-related domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cancer/testis antigen 5.2 antibody
    • Cancer/testis antigen family 5, member 2a antibody
    • Cancer/testis antigen family 5, member 2b antibody
    • CT5.2 antibody
    • CT5.2A antibody
    • CT5.2b antibody
    • HD21 antibody
    • hom mel 40 antibody
    • HOM-MEL-40 antibody
    • MGC119055 antibody
    • MGC15364 antibody
    • MGC3884 antibody
    • Protein SSX2 antibody
    • RP11-552J9.2 antibody
    • sarcoma, synovial, X-chromosome related 2 antibody
    • SSx antibody
    • SSX2 antibody
    • SSX2-SYT fusion gene, included antibody
    • SSX2_HUMAN antibody
    • SSX2B antibody
    • Synovial sarcoma antibody
    • synovial sarcoma X breakpoint 2 antibody
    • Synovial sarcoma, X breakpoint 2B antibody
    • Tumor antigen HOM-MEL-40 antibody
    • X breakpoint 2 antibody
    see all

Images

  • Anti-SSX2 antibody - N-terminal (ab182361) at 1 µg/ml + Human thyroid tumor lysate at 10 µg

    Predicted band size: 25 kDa

References

ab182361 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182361.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up