Overview

  • Product name
    Anti-SSX4 antibody
  • Description
    Mouse polyclonal to SSX4
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human SSX4 aa 1-188.
    Sequence:

    MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVY MKLNYEVMTKLGFKVTLPPFMRSKRAADFHGNDFGNDRNHRNQVERPQMT FGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEK INKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE


    Database link: NP_005627.1

  • Positive control
    • SSX4 transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172215 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 22 kDa.

Target

Images

  • All lanes : Anti-SSX4 antibody (ab172215) at 1 µg/ml

    Lane 1 : SSX4 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG at 1/2500 dilution

    Predicted band size: 22 kDa

References

ab172215 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172215.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up